gvim-9.1.0330-150500.20.12.1<>, f&#p9|[MK)[Xܡ("c؊qGXF{CjBDڠO·P ;'φj"idRbuٰH6M:ɕVP*Ω1F&Nl{z=O1Us*u@L s̀_~𸨮L;0oeQ rc&l|g{6Ҏ"B} :z UFR YS[aҠNf{%o$4fUÜz=AD&5̳'7>H?ưd  ,8<HLe Q, j  $  t  & L  6 66\`e(i8p9:!>@BFG0HI(XHYZ8[D\]^bcrdeflu vwhxy`<zP`djƬCgvim9.1.0330150500.20.12.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.f&#h03-ch2cF&SUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttps://www.vim.org/linuxx86_64/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiD(t/)U C.&F,A큤f&#f&#f&f&f&f&f&f&f&f&f&f&f&f&f&f&f&f&#f&fNlf&f&f&f&f&f&f&f&f&f&f&080d9fd6750268bf1a09ade304b3877b4e778c302d278083eeae51d083e4c58d761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820107cb95d748bec136ced9f94fdd01de543cefb1f2a9888becbd60e76968598c846eec36bce6a7817e62c4b15940ab1b42af19292b7ed37d42e268d2c9131b2db708795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0b0685688fa3eabffad030fb2450faff870a4db4fb3179b4bf87b1853cb625b001d203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa09051e24f1bdf0a66bc7c3d3bb811c5229dbe789119d4dde535a1b92872090cb8f7f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f225bbc8b1988690ddf5be1c0cd1847d3128da54cfd66787308238e7825ee36988cb498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.1.0330-150500.20.12.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(x86-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientlibICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libm.so.6(GLIBC_2.29)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.3.3)(64bit)libselinux.so.1()(64bit)libselinux.so.1(LIBSELINUX_1.0)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.1.0330-150500.20.12.13.0.4-14.6.0-14.0-15.2-19.1.0330-150500.20.12.1gvim8.24.14.3f$eqe]@dܺ@dx@dldZ5dJcd'@ccR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comjehan.singh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.1 with patch level 0330, fixes the following problems * Fixing bsc#1220763 - vim gets Segmentation fault after updating to version 9.1.0111-150500.20.9.1 - refreshed vim-7.3-filetype_spec.patch - refreshed vim-7.3-filetype_ftl.patch - Update spec.skeleton to use autosetup in place of setup macro. - for the complete list of changes see https://github.com/vim/vim/compare/v9.1.0111...v9.1.0330- Updated to version 9.1 with patch level 0111, fixes the following security problems * Fixing bsc#1217316 (CVE-2023-48231) - VUL-0: CVE-2023-48231: vim: Use-After-Free in win_close() * Fixing bsc#1217320 (CVE-2023-48232) - VUL-0: CVE-2023-48232: vim: Floating point Exception in adjust_plines_for_skipcol() * Fixing bsc#1217321 (CVE-2023-48233) - VUL-0: CVE-2023-48233: vim: overflow with count for :s command * Fixing bsc#1217324 (CVE-2023-48234) - VUL-0: CVE-2023-48234: vim: overflow in nv_z_get_count * Fixing bsc#1217326 (CVE-2023-48235) - VUL-0: CVE-2023-48235: vim: overflow in ex address parsing * Fixing bsc#1217329 (CVE-2023-48236) - VUL-0: CVE-2023-48236: vim: overflow in get_number * Fixing bsc#1217330 (CVE-2023-48237) - VUL-0: CVE-2023-48237: vim: overflow in shift_line * Fixing bsc#1217432 (CVE-2023-48706) - VUL-0: CVE-2023-48706: vim: heap-use-after-free in ex_substitute * Fixing bsc#1219581 (CVE-2024-22667) - VUL-0: CVE-2024-22667: vim: stack-based buffer overflow in did_set_langmap function in map.c * Fixing bsc#1215005 (CVE-2023-4750) - VUL-0: CVE-2023-4750: vim: Heap use-after-free in function bt_quickfix - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.2103...v9.1.0111- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.2103- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxdh03-ch2c 1713774115  9.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:33536/SUSE_SLE-15-SP5_Update/abf4439c5c9e7f068a189fff5e613809-vim.SUSE_SLE-15-SP5_Updatedrpmxz5x86_64-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.0330-150500.20.12.1.x86_64/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.0330-150500.20.12.1.x86_64/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, BuildID[sha1]=9d28010153feb5fc8275ead5c2c3041802bed3a3, for GNU/Linux 3.2.0, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image++R R*R,R(R#R"R RRR RRRRRRRR.RR RR%R$RRRRRRRRRR!R+R-R)RR RRR&R'R PPP P PP PPPPPPPPPP P (HŢlwi utf-896f9b3b9b42b5db00a9c42eff1d9aea224991e375998d9c1e1b4575cd7eb4834?7zXZ !t/]"k%{J #.4q #B浈&&6"Wtw풒KWBf˫V: p1ra^HUgjf>tn*7;𶈍7ޢwك%h> [&HR꒮t% H[xtTlkO^?:ehop^H]$ |Q^{̎FddlyE[=JRӵ܃!ex%RKת't+29]IztDNO!%=o@6p"Sý/ֵ< _G@Ҕ5ͮAوllsX2⋳HrQ6}b},BeڪMٍV-oX{L:L(`N_fYzⱏBڼydBYҾGsϖ`GXPŲ2[S+OƧao:10ʳ;b{26Сab Sɇ|cH|Yĥ \kuZȬ.JqXCD$ƠMB}!I|lGӑb}#kDWUgOM+8o"a)<@a%!;4ڨ"AЁPpၟ自RpC8D"w;di_ r2.x&[/#PM&?emy")LKaz@R 22A} vbT;k_C9\a$1/+Dq1Y>fՃ\D@ևmń'%qO_.F Yl UD)cʭ_:С`k (A+6M@ EkG);N iH;i%W#/+ Hڇprf+i?Uz4v~LWA1Ed )p'[pSSӮ2Jk-0͂vN; \sd= L!J/s>tPr"dk-40-B1xPW8GU3ѽ!BԎl!y((oҁktM(wUnFUaJl/~LUD5@DC#?jYuiVoO84iVűkPuqSDS7r6J%ϿnS8()0-2[ vۋ?};'U$P,sm>%GM`b*e'yTtdhIu:1)PqMO[oB; |:^z@Yk"B8WUZ>q" e蠱>|$QJMM|oCͷiS8OsRy 6Ųg97׸rI!P+}q Bj'}a`O4 S\PV:s",)ٛV=؛夰Ɨi)8kNQ=~3*Zeɯ|aI;qX%B;QrHXa4,CMΜM~>0JAd\yM 9*cyk$;t&c!r( 瑖L"-ʅ x@mv4(QOnKMa)/# j0T2nVѪR6E]-fԀ&Gh Wf1 JֳsBOs|FNΦ3CnkK1I'WI!G%A/v} q缽 1bo#!Fl)G;t[J/y2;7-iJTƹO==]w dL;Fd1-܈n3i#$1-QzQE!ИXV6gqc '}UD}kT-- A%drBյ0#rs"61aN8]k"J p B4/Z܁eqKY[=oՇ?nձA(Cbog~*FWQȡki4amK9 $,+Yl7n2(IH3DJ!kc_5D^L_H*@4R t3GDnde%«͆y u\:c)("*e,g)k P [e69TC5&g `_fǒ]X?s]z%tl1yS˸M;{.jXZ_.3Ls$ǬzIQYgc ;33-{NS@ Ύ7v; xN 4ԁ)護)#g7HFp\K^DMr;(6k998cVEqTܐyZ'^ H3.kG FW{\iu/=X^?r!48> p9M,?D %rcD] ^A˧TL|!0F+s9`(,lb/yDO,cĐæH1f)aQsx-Y8-Q_5gJ=}+tco@!BL BO9sEQK+=DEz+?)׳t ǘs; )o2sGz4C䨁1.iK}ҽ&0(|X4K`H uXZD-Ru=GG<޹,>C|5{Fiƀja[ЅĥW}`2,]~j`ݫRʃI]*DNUO?hwc+N\a>SbH3Jc?|J&|یLq``]6%^@M: T%b+4ɰF PQ(6׍/1hVk="!b굷IV-&/'wa7J܀Cy(}ل2KdbVa—@ΚN'Ahxg}#Y8NZ3$4qM0+|sQU>jצ92rZ80̼=YsӨ9릅Bv83~d<+&orpBfz0N3xT?){kC׆JOz?+8&l~J*6'GBǴ](,jGmY_mq$GI U9Df=>H7N H\h,L#*]hdvϭK>X#Ӏ}L U׆X<]gD%[`GIެQ\8 J?AΞZw 7(/RuBS#ӈw3AXݠJ(`.IeƓŽ6P׸u&Z|(.5NVX|D ~R 8K4ү3hGmL0lOSu՚44S,FLEj'N g"oj@]v_I۸m$`JvH%0jmXjeF*2hܩ/:F[%{3Aj"CkS$`1߹ X2ũ}{& l؇):Vx(s$W!u:-|pcgтP|q{o~HMkJWmm;"F46{-ny ALK}o;UR1p7"ֳ.CAˉ͋uZ!Y3=KTūjSxv#fП;H dGx.:cE{-W!1;.YA6b>y\r|`%i$WїV=n(we>9.c?\ D9|vѭrXq)SX51epF [Y P)ڂmAh~AzzP!mgNZIUCXYrb?2abes'\rٟrUopx Va{wn:wv_-^њ0t^nb#\,X-.m Jkw։M>˛e7KcH UF = 8u 40U6L ŷLئ+|m C( ];37WwkѼC]?zm>pd<{:l1 MȏSi^.k͝r8$[-?1^gđq3[L\kJ]A4\_ (7,rSܴw3bcDH`M%7g_<}t0lGl,>RP6w7^ '2lF֮mzMlQϋI8,>Skfe+A#E-sM 'XQaϨ~ԾhWsJ?cp@ž5`X37ϟ~zk`vLv^1B=yv۟)TUz3'KCmWm:8} ,OAh;MZBNmžڜzW+hאuNrT `? &rᦟgwU^{ 8G5/vmEF7O`? xT)Qr- pV8@ ūq8S)+c <5z|~y[#ѣ^fVH7UUnՃv=1O[vR.v*{!4 ҶO&81(.f5f$161VO+ 8FЎha{<ܣ%E.+3 ʹa~Yk(@~k#L<( њˉmtJPif8e#V l!t?Z>Xa4O-ⅭѼ5_"^ uqKkiyt04bX򅚤-^@1TjT0F%ӔTY3KBu|A\xeQJc`%H=Zq')6 `p)S1g qFg&9ְ7TynWv$a<uQ,] v5 93=Պ̪g=:BLZAt]Iw 5)Z79[ZF1QN]{bz[$QҶny>L?R`xWEg ?1A]D9ݐzwmn߼HIlGN4 k'M+f(I4NcD h뾺B!@]yG+L?S7d{6[996?k~zQCښdBO!rMؓ+y3!^dQͿKʟHq̕ 5>y=iNRemdفYj, wBweƠ|-G&sj:XY3JGEe-;Kf"T\$gr}S {5˗#E ?CW@e c đ2'0 EvL,x^0.PKlesvQg:!1zʂ)ZvV:7H5ڑʘ+irQZ1ol #WZ %c&om,cLpM$^Q"oGl6{Qk `8 HUuv0@WaU,J g;AX&*n4Uσ%<| og0 ~ 3>ΰ%еUQCLkRP)/j:iNUܾћrU- _Fz8 W.*(g FH/w4җU7:`[;dٞ2=RAܔƿtLu 0VaDyBF:* ]%FB58'3(8o0[9T=Tetv!̨4^\rwAe1%)=S=: D27u?* }oB7+cF!8>-G>6]fMKlMq1L]i MVY7lXV+FRTOhԹT׎ .'AI;^z鷭Nfoo\p\(hO!{C xeb Rʺg4߮WƊ7l TF8({a9Ŧ;r{D+yQ0"Ͳx,m$qgFi4sveNIjAJs&*7xAaMgG9ƀzd2(3UɃSu Eaa+0O+BEW# tA\Wn*⌚aiԵΰQEJea. \{ >Z]tD0AbN1U6hDB7u[[8Dxp`A h/Q'<<)So/n^(q1$!B<6Y5o6>Cgū[UlQvx~Z\PR-KGJYj!:ԫqVԮitհeÕH;f+Rӹ kgGLfZ}-mm#jpjg#S~ 468cx3zĹp@0;qM9,'ЊZeqAӗ0}3Onefr(n~=,rGS<*oIBLf#7QWbc1I.yт}'wOH=nCm )ˁ_LFܡδէb H\t>I60ec_kd{ܟ)-,\wt:ۂfjK,hH+LԒhէ+>I8j(JwZGIo@orjSzދK +,l ɔ(wIXes_ٺM^&hXA|>4QE7("|TQ'5  WKEP{sm^Y2Ѡvo@h@W=tRZZcJQ(:z3u!LN3CkO b&V=7 F2O(s/Ac{h%{a@'8zPxf$y .j*}]nHwy%­]akf*1d-8L?!h[n[Hªkw/  :FS+;bKV,-Co þ jZX2cQduIV@_@8) Gj(֟DAn;c* )\{a!jui ZZ ō~EW=DiyįVm4js5<4Ы[vt-wSLJ ܗ3D2u," -Y*lp=$x" 7$Q+_ll7|Z;AD`ލ6/SoA}5$VȬz1&& 4 nj_#=MI0\0)s40J[>-quhL8 0MQ,ЋN[ע>l^D\CjtYF:d.B8n\<=u`I ]ڞOzMzb"ٟ6sD7 #eEcj6ZWဤqeqOCY9&&g3Fff_H;w6M!gGލ]m PDu]&e9-h$o b n7JեCLV%zzgb@dt}A?W$=%Nyw#&oFD@%\bs`-}kj~P TA`iom̞"oT"204p\(ܖ i eܪ?(M=qn~RzCr:(;)=^M:F5[=j?2|VZZX 4t> f!nWV>|)@A6s>AIEǏ%rg!~@'c ŽQF8[AK'2 ; &m - OK!dڻVƩQT-ոJ"w΁,';n\n{\gmMmUy{M6w:K8,%t7QgPu+!D,6g)Z?# 406:AI66fҏ GN.niAN؛IbpKYt\gY@||'tR6TlCWC{e3 3"q0Ԫ`.fUyc(3V^$?kєt0^/%P-WC ǒgj;ek̤XvxD 4Si!x;|s[? ٔ7?lIMn(D>y i *]T<0{s<)2洞f)ge@HJw>Yx 2;M"XV+^$<ʓ^`obAit iXCCebc6*Sͱ0]v0JWdm ¼|$&Pa!ʇm9lIG|1O<(*n!J%DsZO`ϻow/­* $b38 wJ[%S0tU2s=6`QjgT?S\qv}q.@{:qa:jhL&x+ok =< wi6\_0iLfr,ac~`uI' ln# =`=.Q,L.Y4H'/SA2 Bުj|KIǰ!&Wsz6>OnSg6諫%a3*u 7hZYɋUvK@ڳ6PbO}.JvcARRnȝCD ?X0'I jx9#$ގG \"8 bO ͓ejC45¾?_L:zD$>EF{Z#8e8FX2H{2sgNEFt jtfep5IϜAU+xm"c@r1ftt"4x sg+-:YO-L=ijwn{4;ط#蓭$47wSŶf?ngVvj>0ؗ@_G)w(-kl#zVb1w7<_{q:Y{|Wko8(s$$#FpROA¾/lr=ٜ:ī{E(tRa Q9 9ʭ"W`;0h[]j t@Q:Μwp: # Z oUǙ:%6eP;X1\p\R21[C܅@}eTxb/i< TH U ?}J!tKZiat=nu!S!lGt;G'M}bxG%is_5?oՇt[ՆQe{ٞgtӰ73r+Qa%Ju E-Ɂ;.TLy _{u?IFMT"29*v  <3~ tqu8=o1e2b:» y?WFNta,~)ʯKW1u R,I_0x=*4Du8ͼB.scg!%Ff#ȇbM*aɂ>qk֛ZjKgQɮz7>1ȑ]Y w[ SBEupz@W^X}1eMQ-?LLj?I?*`_~ToUJħ @ ?E|M޽9.'ŐO|[G4,cWOZ:ExFb =cM2̯?t<Y10tDŶ~94Nj8?,YÆ,&1Z+xena描͝i'3(s|>&_&d*LGf rܚ| .ϧEgYZt4^G_˵ut4`Fv|Ju7i̗)fWΠ޶YY,!^- *,k@8+܉g<ө|3Z$*2hr7kfO~d;Գ0!z94AnS5*&[6Af9r"ͥMPRV/+ri O3gF߱Y+0 뱍~<}Bh`3\O?Z]9|nJm;D/ ME2.Dl1?(cQ!WPoGp#0јv|n25-36HJwLQIebVrQfXt9I]D1c#VMGm~-Xk&y4!u]Hjσ_QJԁ*\ _guuS:SL,c)w,lncT+pv cJ4 y^uDir<SBus?df{@Hho `suQC^fքŨ||W檩lF!\.A yH@+WlH_4xH{jJŦlk%bX<:>Z1 ,i!,RR U;6ϰ-9`zpB0tdaez& WTp 4`8+t .Q2ȥ'ax8=*S$Q( \~ݸh¹̝ vlf?^i\(r?r7F∮zcQϴyc?Do'>򅆎& 4q-]#j]u(# 6FEpJɠKB JY;4QePvl".sG+!,n T̨|tIY}ɀ@`Bm@-̃V8P3=pjP4u8Qw\}K% rpr6ۓb rg /rvvY'Xb }Cmu40eFdbEM(CtUW4 =dt`Zo$\}ٶyIfFm$'&$ 4?RN Z OPɞ"y25,we{^CQ[%]8_cp;D|6&1}bۄZϫ]`K s5^5Ge֖ߜ:K[1a9\B Ir7`}&ҫ'mSp?!*xA8(.,vAep(?ڎY6NMWB#c/g'>LF6_gkNA/s-FIpMr*xJ- v*:5M 0<ff^GJoA"=Ŏ ($xazD0VS>wO}/M?(e>rƂ*ŷW`|j.RqKg,>(%{gSp78Zj|nٿUQՄ2q 0ăz㟊2 CKs7\ K5:p #}20gINUxQ*L{ex?+:u.!f[6 f(+>6Ck"H ]'W@[hzu @,89^8Խַ W=R"8HmITs;]ki8SGs%cuΣ֏RE7Lc{]Ӽn9zJss'>CTl`cU{ xquҐ[L\(B:#c|Oo``?iQB͎dVAC'sސh[? ND*~Ikv_ԃJ/zn_`ඪY|\Nw=&0̘QJ_:YjP3>'_tСgϦX&(M?.C]ss_\ "ɰ )CX519ĿpJ2w #@v(Ыc" GuxM4Y*#~.+`Nu)yr;8yV[-<K) W^/b6,Ǒkǡ`Q$^(Ԉ8mӜG>]_j =x7a Dլ[q0Ll[IS26q'p0.ji߲Q3h)B窈MiHgsSu΃y`S> h};i-UvN TT@V9Tȼ9qE 4.}&ǝRt7T$w,'*tBZzͫo5.lɇBCi~y@\4^8:f7c{<e'$: 8. 0v*!paN7an:fuupsH5 G)5vtny]񗬶(LٱCq-T>ZӯW#ݑ d\ !@Ü9j5l~˴W4-b*I{͉6Q'R Vz% gMVHʐoc|Жu$_s}/;JLzQXx  ~j}X#}3,FS& ɇ"4YUę߯{yȯ9T%(]*"E/QHE.'iIBYh+,ĠF+>OŒphN[ "{\tAGg[94:wa_l%svq_NUяW 4M(:6um['6;!!g]&b]К,#zT`{+Uj1` 0`A==v$~nv]?y0ϻ0z0`[*o}CY3YI 15&P#8rA1qs`.NR7C ۹ ujEKR BoǍ _O3[v,ފlhP[^wX gRE% m-DfUMvZp6U$*r)(m\鯱~%ВwJqqSa%.F;2d-5Kq⑔Bz |ueiۗ*EIݖp ul]:K)e z'Ag(sB@9bg`b򅗽Oy R_W?6$f']L20% C0+:[t(Gt3;x:-Z\+R`itfU:V9)&87^E7/~$T7<ҍb\yjb9SYKWs_k!s 94ü B0_rJ,{|vN81&H|\|{rUMZE'#eت7@z Sjx>'+*j9}f*:9GY;/(sݮu2$rawsɞ!8O2.6. 'C,vI, S4;D f`rTLڹD\on$\UDˊqZgoE`i*+WEd"_"NI?y T} CVqic˴gƆs̓0g:Tcx~!#y֡$sF}a dn{;E 30tggd%@)QiЗiTI(oZ!͌?a`g@ɿ$1=d{[+g;to_`$ϧ⠯,rygy*"nOojrR9o'U[no[;6\էXoYQCoAOT~jc΢﮹[ϤQ I~.lR{{5!Uʳr>1 {#3<"Z7, n.jܪzLo9Wz½/s1rjH'7[n1ox;C hf7*SnFނZzIF2F.q*iQp7fHW< pjcd1]gRϜ >Dl/N %}7UK=0=.cgΝqb>p~\J4HdJMpi ,A"m 1YSPX^%mt dɓfZ~̠_W;\ + 7Nf*2kug!) tآ2Cz|He:)3zHaVrD"%#Dfݡ&0\n›Q}wmPRMa.j' JHr6G<<YN9 &GQN{6:^G?<1F*Syz| B)mЇ烐[@_PM8DؗjzCt+9ړUu% %i/бbUV۹&]@I#(0jQ-SA\qCea0~ɖ9.^J7!GT崢TvS+Vw2**])ړ|lv9#c*Vvm%\ QI;:!gD s Ձ:F65%AKf 1 #h>DZ,6凋^jhJX\0F$RtD4-2Ev`IiT9An_p@%HjJpWԸOżMRz=$J:^@6kW3,kPC8N؜E6tܓ<ԊC D瘦2`4H j}Bwp!r Ci,+Ct8Du"(#gFr\lܴ˒a2^pDSTs2w§s]mgKfPL͡}F*Q~樢1MY#s ,FPm^vKT=sh 6=4`"=2d;`uYse!oȼUMcжI+zĂms1X-0<z(w`ST1g*Sb+8|r_Μ^'iҼ :j .'>ϖוoW]Bj#Rj'p*'bZqNH"lxfS>8ĶUHǫLyD4ںv384 h!yLߢRSe #!cMK][[b*sR w4O%vLb/b4`(0mFJT)aZE&,&@uF Not ^*8mv %Gm|f}J-4Rsf@lj!{!ߟȫ7aMǻoVl#4Vx{+9bsA$;Jzu)rr b@2sX-KSij,{ 7K8gA./KxfGf_JCT '&Ɓ~ܷP="N8L5ȣ;B$XlMG#1m.@50X6CMGAhOlZt[|d0;J VqWzjrR HT@ޟOB9w-w-sE<Ғu// izRe+զ7KA ;s0iJ}i/L`"^逸 J)|&-:hYBO YsrCq ; % VܐLW,le}e 9e9Ssc!wv_@DxSm\ᄾH+mO_=/."0!Nl&7TR="ؗĖ{Q<<2R_ĶMSG}!dW4NxW3RW0eD y^CZl J_i +GݦIJ3 &e`kW"BLA D&dy<',f3!&Y{O4 cXe~F8, 9W$fPAW{q56.0ܣؗR[^!Q=^o@6B.B~qZ+R o'p T"1w=UOY櫢zrK=+ȢtKҺ?L)p`c+Ա|CN9 Lzhz o Lr`_17:V,YgōWpe+wKEx)ajP&5* 3{3Vxѿ2+}X(I͛g6W!70* i:CWCFQZ^8(Z 5eׅXFւ<9CW [=FK\xBA4#U{K(2$.pm:iJ3/W\i#$Ȉ̩|ݎ鼡IQn+hsGك>΄_;J eŔ@={hڨq}L9SNwe.,)o8~~A@O hǮWx^ tJiٯlrI^NQ;>q>SѾb\ڊr쒓K"`IUJ< Mr6wN{CFhdBͼ QFdu1y-.xİԞӎ]Fk5^3mqʴ= ## R%H>~G}IsʑviNL*L8=pJF'܌q[S, 9C[U%qC٣z;=/S-T\15+}eFhn)L`ў8<6_'h|-,F#H1uOf)fjIӅ !ijpz-(}gpF]%| O/uqTZ-k}"ᜫCu &O-dٛYhClȀ} *ՏLʇ:D[h.9J??Ԁ_ڔWgLw"oͲ4WQ_33lp${]eO !a:􍮙ieCvb$p_~W 4@]zJa8+2sޢio1I\qgI}p^A9TQB^Y2oq+E琸!Qni2\GKD i^⪛Zdgi6,0_ MrԀ9Hϥ cGs*Uk\yZT&T Mq!d%笎ΑPKO$t̃jMy!sRo|OOy#<`s%VOip/ogrloJ/k.‚!"&m.[/P^:CPĢxR U xx$ ) EL{*xV7\Ab$j eˊX˖N AQ<PW(s%}` pO?~\ز@FLDgRR]y8%kla_^}Y-HNnb[ь=J7f ?'Rt*qyN6X5 =ZjW2tn{y"O*Ijl8VhLe9ܢlT67(|j FPg^G R%.9.?N8R%5`1#FGp}Q$ ,_7@%YRfTud0hkf`w>Oz,^)ڨey x_郡){iikeՒHSa c96yޣLn\r_n I1 c͞r\;_ª޾e%Y [nfc>OZ&^\6*VoQ.>/'- ]~S}ZGB3yc94!aO?D~^P,X~Ve ].EiLCqrw, "r4ٮ{-7Qҳ : -wZ>r{?(Ip.]f``u8?`L0[ȗO-ͯ~c&_[^RN2Tmzk *-} gMH۷]>ekCcŢeۋ@?@Zoz]xn*\1ѓ|S I}$+tf\`z O2!UnUblF/AGx]2y(F | f*PWtKꦊ{fH-0u[绞1]"%^kX]㻂a%S㬁v4n9?Up h`c+} \cAWZrO|~ d}8l%ZϚ-˓A{?%bM$kc.Aנj {@%f,(Ta NΒri$>`FQ)6YX,JrXۤj.|Rck\S +-YEЃGyo#KXtu-DQK#N)}ޕUAvd\eXOrkTr-) ";]h,('\dA 梥vDqfۚ,"v@eAa=j,a_1۔H 4BiTߢc m$b^Y;6 gZlJXE)TM @j Ty$jw+Fql֑Qw3:5y>Y>=L9on ά7JuHc5rZ-tUul׬lYnXwԁsu3]A> P (Ja=jO;E۞v#1OK5< U#hǬD[OT )^|$iKFߗ`ݚ !Y9@?N׿(}~ne}菨^-{?Db9D݈4ZL;.{U똶TzaK+K28C϶zl߀%\R~4#Rz3'ftx,׵" JɚsfE>ٟ?>5ȏ:o Azջ,5(|I6b*H?JW?ϝz;*WH=$TMfv]C!.nFk|OݖZ~a?k٬+.DAB,{?I<_LoSڴEpڦAvˡ(}nxlQ7 m`.B4 27JO0QVd/i K0kAZһy./ͮ͢]MyBuu%9XMBV.o7~V+.u^[b^_B8d :%^#\%-~4&uXXi ,~)]Ӗu!PDảQƊ 8ineZ$tViV>f.0D]%\lDz(_'uhPR^LlɟIFif0kf6o@8\_HMoebEw P`y$Z!lS*Q%aB""ܖ]8jƤ@30.QdW sL %>q=iMec69[oi;7BnZ4}|W'o`0eyH/R{ٚ󇽍0͹凬ͫդG3R]bZoit0}r+Ȯ |*SJ.,F VΒH] l`X&B 1Ƣhs}Px|<~OAh'mq-gCW nWߴ.k$NGNGc^AGQ#Ia0L^L-^~BJh[N ?]pӝvYKBb2xaPGMZk91-ۀy d2*e]50f8B_6bbCx73C(Ի}QW>'X3Qb'y򗝅SF o t$oP}sEׯp}Cp p"Y&yfvKZѡ(vbq`u U`u&@-z%WuHGЈLO^|Gfcwvhlr>J ]I+( `<4,Ŵd'`kϱ Q~yZeؽMN\!GjRZ"LoaجJǹەur?eC^0f&6ͣ |@aHlF6cAI%KV1胹 *%87 d#;'Sa^- %0% [ Wi3^|IXbJƀFB>sжw௄nMEhvMprv]zHPOsMEoI SvuՉޢ=c΅Kh]&¥Y'wP%:Uϊ:@&-]|of~TX} ɥd/<31( 0TTOu9hB\2=kr gfQB +xnڀ.H9+0[+WX8:~9JL3ʪSsڵz)Je ;!e9GF19'< Di$U ijcnZLh@xWTgu q`]>!Dg KkMU4bJH̨QoÁR49[慞(e:LGYP~V&PG :ntˮ3p[ nrQGsaWi\/?g,L3-g4%c0Vh;Km3+$kv4gQRy-G G g$<*A%njX͂?Kn*!fػ (Rem/W3y7ANmޫ\u:M o R*8u[>TY:=y $rfh)~Fzˍ,v}-)}wr\[x2l7UR`}K1qJM#9s #$1*;pA)GZP*d n+H\xɎp . ydoB?5!ud6>v2!ƭ١wήmX~Am샐dc5O 5U`@,N26 Wy}>^ -Ȉzc o80<7ܰi }ۋl<$rB-Ѳ655 ¥܏n)}Қne:DcL[EBvq! bjrA} @]n]˶U_M#sx '{ir_eBK(sDO#QGVBZnA.`e)%r{3p4YF^d 2\!2rŒJgv\?x}#ZS+2o6Noby0f('j<ˇj]e&͐zS!YdK1@gҩR}ZǺ[bࢽ@&fKPBV&0?ZFȁtuN%6[a pwg\M?yʰ䧲U<$mT۩3x-zi-tjرj(4y_Ǥ!Pn<8Ac&q-6&W~s+qee#qkZ͕뚴弛%)OAאtRލ,*ۀ}\V|6oB6N>#]w ƃ^ E`d|`.,)(t-'j;>ޟf&1Q,*ER[cc-[qe9`04ȸPckp ܰG@o/pR1  eLn0W6[d'>gR䮇2ʕ=ZURXȠEg1euxRn&KMiz3uʌkE6ȘU?j> W}LQs~N4-H J;}կ#4x3'EayMBk6U]u"OILwAҠ-ޅ)yp8C_o `+Izd蠸1!lX"T/jjO^ɳ:]m~*x66!.տ$˖F?W$Tb<r?Q X״hjl EBBv앖`f;Α/(v,W˽U$p:(iJYNJΧm`vkJ}~ }ތ9OrEHb؏R,VroL_\u,gFZ[wxgQBAOzoN1Nixd^K6,q\Fz}q䜶Vч솟e\{LJlΰd$ Uvſ7WNÊaoP\(U r ^i27Lzgusz$XduyT:CtK">a^t'_>yD_Ժ{IoF y>N̝!^,@+@=i :glZCFJ\ ۜoذ}GR>y'{SGvGԨW;_fw)aϦB,xDn YdmXH~>΢8E6TAVտΠP}ԏfu'A>h/2SY,?7\DoSo@b pxVhl@ ?>yFZ|@"'awQ{pMMy$4nJ?|ntƒލA!vPޟ_l?9 5഼>xMd@z.db6s k:VKY&n.AXFm 7Θ.XHZ3U^ELj;߬тz,AzDÃqr|sp@ByEX%zED՚jFix+?ɱ~0/5QTxr)`'{t f|~HArrZ^R6 ~z8K+!@=lxq}&H6$FJ[lrǝ% \zv *iO H_J) V8*7kj"4-%7!Yێ2KE*Cv37E%es-rsX ܹ$fhI]A$]*!a1eEˢXO,v= ([ d H{?CUF6 =)Otbk2rfҒU\Vqdcz/I"\ɶqD&_*UgǁFKi1h]"u/yNEq4>&D:O4ck⺜vGJ~I m4ӜS0Tgt`Gd 1k(485#~w~x/(')uC[e@Fys\^թ,WؘP'NcʠDG둊}uIxcDPbt8Mc .c'w:6H9. L\g(s'%1{[nA3oBrd≣J"c7T+:/R Y0 &_>[*M%|O|2 &]@Jb8yN?Rk=pFju> ߭0 w,: A>i]BYOuvR] s6Dv~ b]!Y8v2{mi_R4Oh$|lwnɫ+㑯pYVG=Q~DH53 ZI̼D 5dRb;?G9 #@7Hv ܐ:| ȭYz;S\&T0y*  tR~$y.[b%9-5`l7)y;"&9; uI|IcOnWF쳹-{61zOK}]o:=k츮.nj&c5οi]ru *3":ۺ Ye AN. U(tE@Mϕ!`Ҩ^hفcRxef[$hBcn}t+yda T͙b9j29{!!ȴ5㨿KQpxıWpLhܠK 14pk0m7 y5ˤ@>֮:f1=wE{B!<u| dz T<Ɂ@/ s:<{~y8LQ#&Qwx;=E |>E_û,jmZPb@! :zybN&,]~o (> pYX394 &Q<1-'n|{j=o\C!xc+;#߿#ҙOmG-= 8z!D6Y\ Xqg\HG!"}' (+A{}&%V?+nb2xڧGrgr/n@/)ą̼U p4kGݭ+ҭ;Ml|m0E-1t9eQ{ ƙw? 'Q;pMsBTHPNy;}ؔ5({KzvF 8pmʯdB:9y':Q)kQ+ܟ$4'| ɯ6d~YZ*qI]m 4Nfo8FDA|=x<3}r=AB?-;sVХX  lP"_4Xە Dx%.)8FOԘ$XCgNZ)a߱YқO3M16ىe___] ˆec'8mZgd T 0[&T"L»-z:S  ؉͓,k+kV)}Miy?K䔏s,{4B@P::HEZLP^:qڬ34}]3R[i˙ًj==L+C1=*ʥRwpvc uE s"e^)FDdۥHu6&ݺ$+ <^ H 6X.3h3,+sC`;a*8l& }^1;}#Lo" .N=s#\=_I3Kz[{PySBd|(MR:29/MGfh܀ r5yu$O[\|BÀė>x|[~3k]z*SDڌr$U\t gb0sfFci)~F, ypuid>Yب͐Sq:B1gC@S+alD"j[Qx Wa+3bfMD2Y&D'&- Xa˜gt*g͆B-f]hy 6eʢ܋M"Rfۯ)E݊&.WƒSG]J||2vP,ǎ{eG'&E15ޥZcz'#ŠilfrMJz ]ojP}N_>3@ӟLxy# zΪ1шgI[(RUnV7:w8،/Atkv,/IRdpNsx} $ydGdUŦ):P2uX'K+2,}unyd)|h4ĪOe3\=szCb霾;)QksjqKMhX- *[\}Z4p ğ%`> +Q?iRYqlEJWR7nE0Fdv#PvoZ b$hyC[ʏS( |k$pkWtxanIPQd+C9sH;w}۔ E,n;zBoi(цab4A_cZG4n-qf3b XӦ> c6Ro5]Ljsg' ZFyyQ<^<4B9,. 5l}C1T*T-V{; GW$ N6gz N yLVkIy3M~ث /5J)̈́Uǃ>U?j10}}ݵ+룈D *5"j`=ȭ+qS-gΏ|g}Sڲ@)_Fr2/ C؄× A-%j"mdIIXN%<Լrg ]nq"$J d]j=< ;2}>Š/([xq4O'^K"(oNQ8s=QOu\hw,79x 5V쟸 [i;vIkSҡG_FUyQB鲲Ek_̇LءJU_5gk}ۙ]֯=Ks$H5e1:6)z-yTl틘FՌ˰sK✮P{/tE[-QvX-/.D9_5GK2݋j/^C?4ҔkC(>'Z kZ Nwe! PrdGV=NqlvZU N..~+~)x t.*A}DCurA3W_1`$2&=<.{m0cq4- goԟęYvu$OJp\u`QdzJ H7ď̓X?Dtxϻw|/raݗ?:ɔpX l/25B.Z5hL97xD̍Wnx]W K\"xJk;&sE` @3|r;A{>@ѽ SVT+2y1 MA@ ԥ@2@W)ĘxKj ϴ3ʒVcQBujiVKdbf]Ӹ!Di[AQA"b6=Ƥs9[OQi׵Jtjr1ӢcԐIݗ4\rqByN J[B4gt+#B>ҷʹ`Bۢqо? $EL)0|L$'`A I[uYdAuGx,Ah5; @-DJO<*n.s H(„W&[lS')`õvX D6lyvA<>YaL[@|0KzXg2-p>|ub15*t֢zY|^l<[Y}ԝ+T|&E~%HV5)>@:/*>w`2gaG`P`?ȝ!)^*xb`ݾ1l33CwJ*Ҝ)wЈrU2c =1Sp#/8ry/FR.lY)%C޺s~[IfF0M[sm8iP+yʆ1>H<"^9st7mcN~wFyoyjEZƯDg֐ól"C}mZ+flL\z:vam_tMg BҬS>SfpniLA6-K֘'!F&Ńe'.DۍW`nMYl 9;rЉq*b.HT}.W(ǯV72{A#mECASF S׷]3/ð\ (=,yoe(v_n64,yAHTN\Ԙ #FošL*Zሧf6h>H%u CZ~ @$۵]m4Wưǎ4 TB-&?g g0aLE ћ?}1& I眝/y^p]w=Mv*Ò+Jz@өlSf <[o49 >>|Z0]4tkɮ%Am9`8V,OZGQpQ;x=͍˺l%'~Bf^W^H<loՓU]ǝEPGr"&5uT]|njnCsi}72WO Oßi> 'y7)[0xmnۺ{" 2g&z$‘ˣW'>;<֜oD#[!|~)y0`Z _24-4֭ 4!q㈱M\?0d( / e†W~I|+`6 C^ZաޫJ rٻ?7+nרhA"zKV ^*yF wn8lK}v0qU``2;pe6/tF?T[sxOwl~i=b/ L8:mxLW<$'G@xŃ҃dNbYm(cybߧ:lWRAqګ e!a*:B Gc_Ylx yM kE?*\4%=v@pdaNKE˳Q∔=4=*pyyy7M~;)ʧ=\( ;SPǞ?_Jj603kWbD#88uլh1z>tO9&U= P'ZCBDTT8Aڴ]@JO\UV2F`-'VR 1Z0TbW:q (2Mnd؏$V3s$X;4}e_,X.(zuBF^,.7ԕ"Մ㾈$+EJ?r~{vz˲Db<fy^:d7 {(Vy$f8S*W/5T乪'q&|b@0`;iKLkLKE9H7o$5RjvE[Iz.ocBA[-|߇˾đաy,7:7^fӠI70n[IhlD'O2CyQeF㹵Va<FagVt6T[A|!/սCzes\ݼ !_0A]Ob(Q ꖳJ8}Lv@M] Q-0jO)F&;wd{Iܗ'ʳmy}SZ+|Dho6 kA;KRriYz>vmvM+6"=7 ЈhL|`?3"Y&,~ VITZ ÉoZh"kw}6JsES ,ͅ#1j<|Ԅr`!9MFSFGd++@^@l%lr%, "KAXztDKi V"^!PdH G0>v26H`ٸk:V>LGd_tK|>d6ѲfQfe!Ha7tMn&nJZGI5^޳XQp=vAA D/ʍ[nuSTk<#u*Jx^95QRBޕVMDM:1'ZVl}.WlN7fd|uNGZI크!m}9ʂmѿŹ{ET"E֯ }wRFa^7$\[[9#^PצסBŧĠ@v)7)Hz4:c?Y2 v έPVꗆnDeE6)5K.U8A4 aE=E'vA5p(cZ]NF'93腫~h?`)dgv7 M6 ;G\2}QڠÌOlj-8 W>'eWRaK)(+ˠQWuٲJ LW-'1KmS5N2-Kcy 贐fD#:&sJ u\Bv'%Xuc۟EHΒ%2}#~58S)-}6n|n|wIʋߠ,ScYi  %\ cs}jۆN3Sg e&n^Z{Hِ{~жH;]H.:I?q8k"nX R^yLtlp}XL* ~*FBJqy#7\!ʡ!+cUyټpp2O^އ|XcHpjD;1(ns_K[DyYɾw!hسMfjD7 x}=b5SwIRFr[̮̝^gMɼԁq0]*rkKj.5y[_(`'G Y"#+|#8'4'+h9\c(ѧ䮿OHZO$./uB*݄zAf`lp0a +!LTk=_UN"(~q!k7OQjDџ[  ?baO=tL3]sٓ۴,OՎ:UNrj;}ϫbx/̨*̾SA4xڭSJ|%YCH3wg M0hZa8QZmFiPCR74Ղ6EPUALJFS˾WQ$4e,?<IŐ LxAMF&gL`< =$8,رOF`2V4W%)O&J|RgXV0JQ._vIgsC>LyHhLWdg'>UC >CvlFɟ4!zisJS@briGsV+ %ӝ@6x5k9q9k'ãLE#ci(\gCoQ~70`ot- 0 n[ "P[0hi0áYaÍ83!%.0@FcbJ5wҞBux !}o;"$±fG}$$<\El3 5 Rn*^CUU|znjB։w$jnJTRH'0%c/piˆds?:@^4l*H)~mprq9i[v5~Ê/`ɿw`B\v<@v1b Ny)}e`糖vBQ }uoq/}*$Y80,oR+3 tu/%5W<'AR. M]|0Y5yάyL6Fkv3tZ+ 2 0cNKؗB6<_[W_ޞri[ՙ5ObIF)lKa_5^1 -- 7NJ&ǽ3 $GSH$e]y1Lҳ婆ʀc%~K2}t:/DװЕ97> 00gͻ1]^uy U.<^Ҿ-'x\'*\@j9f]6f7lIF DjeObnuLUa1dA2U㚍Ja.rNFJ}K on(@V|cۤbG_d<cFG#&yT+^M˵Uƪ}]>kJ+T9"uA8fmOjsoq3+.vHE'Wr8iSSVA$tP/Z?uH\3l5FʌW1TkSr^.D6wNf%? bDMse OIbbȑݸ@Bbq``an~sn tzEfO1di=]y{C>oKmG>D0`%: [hzF?&+hWOo&EW [%8c@ (q!>s%\@}ew_9=f:3uU:/A٧n.[D]>!7&pN7Zt ?Fq ໽mԳ ?N h~ڥ-K8W7ҡg1m{m( ;22_1mTF'H3Y:9T?`',S' g5`9]# /W7*zf3ՐNvْϼiS-ـ"M"TVKy])Lxq=F>"B Cr* Xj}ͺ{#kJu"rQnm4jl ?_uH49eR2 f!'CV&EoK pVQc?v׫q#]c#_0ٯeY W\tC\Dڒ 8t738_4=g0nk#.y2\RY|qI?BpvYgyg:q29q4wx !o$~p SHWFX(f;fI/%-F,N6+jty,Gm ͦ|ŧT:dqxGnjE<-KQBK%>Tc8?KjuUW`&(1=VcOwz2Èس*X,P(>n 'ƽi3J*ԛ٥Z%NcH§/#~6s/}7}z[+3NjK'&74dYt*8L1 #f`pa =K@h `ғFp?H*-LwC[v!O?C, Kv$C#o3 _C@lҌ7fm;GXyG:MZ>  .k c#_Van1ɯ^!TZٸh:H g&vs{ VH/MVYY2Y\#e[d笰qy, 3)R}2+U⨊bl(?gxShnZk"Nh<<[+ P,MtgJ Do~~t9 cS?fJ 揑VjP6F{N:Zv2XgsŧJR7mfW5U@zT0_{6S7>v&dX$Sd !Gff`[͔Bymmh`/gA}Zk,WO>g&vzH(@Qr=d,,+mٌ N5FiQ^'\YܦV|Ȁ͎$R % g%M]sqXR4=t0[?ns9P>}JC%–́RpӋ=j.EW Zv1> d>t!|=tlP3nATnVkqR*_.JbU xZ&aM1gK|Z~e XPZ QDž),Aa)+ &Tr BGP'L7/\JE~](❋n/bx%kr-MÁE3r u5[H }z&x8Y}w gyvgBX2F`"|x-ivlTCfD StX)HsX k>Q; t%ձP>aaIP?"`TU'R+;?lTGAtʔup& ;U qe%ІF¢zNer#" w۶tVrstvvY⋈S- D^/fAB'[W Jrn|B)RkA&;a],|^C=G' 2aG%X4-*nǏezԦ?>./+v4ٲdެ mC:f;\!4 Wq8sbK` >DN ճ 7æ˄殡deeSj(9tw"Fɀ#t OLjR0AT/ᚅ!pYE2غ)u4@ :Ϡӂ_u&|8a]Ա[nv`ȑy׼x-@NJAX}my]5R6AZ 1hAc*К<[pL4˥--t>&4cRHQ)+eaI-֪5 C&H4Ӿ{ţ=Y?<2!{Z6G:NG? w>Q!B8 _;䨗o|)k*d9\Av,2vqC:b&`?HGA6|c%sePFMBKV1߫Њ'Cd>No~d!ZCxԺ}afS{T3X=8pwa>-!H͊D_G$W\]m} O\uFCHr$XQK*$Q:pb{dV84hyq)1RAiﶴl!qԒy(3iyu=ʗ!*f$aM7ܾc:!4׵uKh(lϵŻ(Y6ζRt3P(icH.Vde-LSu۠7wMʨF?_.S@ 7_ @DJI}` ?H#v "Ðcf]W$2$[ lIϭ[_:R`no(%hW:Fc_5n#-|Q;ӬwC`b7)7[h{"h[`B˨ )tx|B8irU!Fѩ(pyƫ8:{dvid7yNAgƂ& 'Ãk=[44:G"NjFΜUuRH.q#fv[nҸ``ƴ^Vx@sBhJXS,XIMtfH"+]D{R[{B7]ul>O#}{1]A@ Od݋_EvZT2oyn%ۢ@~V_1[ɶ.`믙\__cAnCөvm3wtlqC O03+1|HrthܝA^~eE'n!DoSG)I˼6͢5^v,u&Do\ng溫y&^(κk 4?smA&ܵ 6nk"=z<!(4?6p&ˡgVުij3*ԟ5{DA+8k*}ɤƼ1wZhYF$vcZ*JkZB' Jd)TL39+@31vH΀TP%L1FLh- "eW8u2 þc'39c1t.Vr|Yw_(yؑ̆HW4K[LVhp718iGMkSb7Ct Ƞ9)ȐջS!UےKOKM@,@ؒO:?rEL(-b1R|:Bkt+q^;XDg[Tx$}Hs6=۬Yyq6D wSTMNBJC@ڙeBq7/Q, 1&YNjGKyݾDi̡_XCbHy}fɛ |4Vio .bJ ̫w♹Wmu?D0Vnv>+ɢ^թ7QbNXttIJtN 1V>`ŎcueENB_Է5L_ZW~#f**-떫A'H]I's~@S)ӆEv7%W#.iO!Tg5V<K4)lL A!QZ# u`jaM`y !0y(n" *֍iڲCAv,"F4h 5l*=/;9xV_ 2; \(kK:꒰0m9̾f6[-lDw8??<052T{I}CKþNgs }X $bi ׹k?Ԯ!ΕK@ʍJ7)\?BSt30ɟdGF{%< M 6ɯHZ/Mi^5\~`E.0K19*Fi\>e1nH\}a{>Ƅ: e;SZB( X k%WL i< QG-׀"SG+ָ_$肏_$r&JqFou۫j9w/jZ~H$mT%ofoַjڳ:vD(?!L ~e`MP-5+ڹh"-ڭQe΢пV㏯Dz?7^;S8L14QWf!D{? Ўk3K]?Vc{<7&0aV0egNhyֻ97*.~Ndә$99WBca59 S~NZžVW0G2-4s V}~Bd>'}N37t{m.cx{ňiؖė(MUNV!k^ǔOUi)‹ơ2RV*pa'|(&,& F-pSI_McSj6b;+(2&@I_ӀK?6\YwBt`9M08j1~H_y;ChÝ[03J*[)N50@5oEJ3'8%:M^?`e]8XP9~ZX 9 };uXAD:ߍ1I3Y jp" &>4[@?94Ie{~Q L,N߹.p.گ&!oE?z/E7·YۖKC58bHJw YH Q;y7_uZ0k>S@gVgRءw|>y1 &!Aͼ¹l睇ȥs.tl5tõHA=!70>rEr⼧CC(Yn8a#d.nq* `gcqQWfKJKa [GS N<I(XlA h uNu(D,Qsvk81tӱL#5kO҃j77DgDy q%՗Sֿ.7ހ&ֿRmo_kגJ?~:}wVYрokn@B|yBl'WSiX"v1ҤBUPW0=&'Y MZɶ`ݐZ0l{`H_x>',ґL^ -7yt.=f'5U}S7oYnZNE6XVTpAQMވ򿿺ea"pNZX"-RdLvPB-0CSao=nHAa)OCESQsTt1K~(g)&P9bPǂ!! a|EvhޛdՌcʉ\@3Wѱ4D&i=sM[r`ݭ:#rTg>/ƁB-s n]̀)/\z->m:z q(g ٳ VoSk-OR85t'I+&9S5gyKQ `l~ y>+LRm`ҿRd ދBߝKirX۲,|4 S ξY7)Z-!i;DH6I$L:GErqEUtL+1CN`} ޟ 8y8>LE/6p*$ Ppۍ[y&.z@KrIu#4eWпz %|)L ňɞKͱ-3TC {n#׸QGqE8'*"ѝRXk ぉ]{yN_Nq '?M+% *V7B)Pl]JąTşůzw=k[<ô,gQgV^Yhuϋ#%șK;;e<*]PQ{!_CȲ8K%70"l'cۮlub%bY4/Y s8]-(:bY( =9昃 mZx.:Ug Q7Ѿ@ Fgݼ %tCP7ީ@ѧx1ܲJ)00p]D$MFNn~|x<qg?O)1EU si4KoEMy:ʻV}4)H~ ,soݽFuJUvj6'S)::Z8fpb @MGr5jƗ;hlŷ<aL%a&:Z{=;uNoa28=i4[ȻUx5/4odzjr Vav5 ?Z@H롬/ift|n\jL o#$Up}b5` 6>Pl"b%ɵ]R:\G˔ޞD޿9U#Z!~oثx+$wq kbP͹N;]}>~DKr%=!`.dqk tABUr6:p5$r$Hr [/S^ *Q9$si=!°3s8C< ~za{Z Pm8ZIN[VO<`NanuY@;x x=D澰h/}Ңk )&g%O;tq0YE4֋T݀@q|]AI$5ؽX};-. йH%oqe v{3l\5m$dò%VhO!i@YOjƃ܍fEd d[WK%D0(v ;$>z):P}Jx]S1mwZTj ܨw,|2O虎M 3 VԂ 9T!/))Ӡ0ZGбj NJ;QŠ\wXcuUa1ְ25!gX11f]FsAsb,@zLS.R/1m'\{=7$wHQ|7r,1dɘuZ)`Fإ?-ij׿T\NKBhlɎLZp:FxhNu#އZHp`QK,jx?:L@GQ6^f>,$0E;x$yk_LNeSMQ=* :s7un?+&ތHdᙆp3F1g/ *iLq R,56ivH4 $+X+zj`:ypwF(WB~ )|:>k+NuIepF⳥Z ^#N+ZkFZ^*Ǟ36&6e]Œ[Tz#3|GTb*/Zd^y/P 8uS=gߟqgTL4%V#auAz"V,8}ҒL3fh&[յ: JeP], qX[c:4S0V'WJw䱦[ilؚ\ƾfXPڋeb(y.#d@%UV74[I#C͜tkz9XnQ7@9L!+Pwtrj3`T0vN>}Ț 遐%p;H[oSѓZ ŸusK0ąL􋩝C++[GÌ o3d4baG'>k1&Dm[4qz%ɲFsV;N]1λ(Gncu1SF}Re F#=|OsV(Τ+ Nk{o,9aϺt'H.L2E tw@FbpvnZ+,Vn`@+\+9u͇($dj.QGQ.({h$E#WTlvPZQ ,#n{u"=eYM"g,P@)1f2qn.p[νt7G*oX"Z.դHkꅅj5p‡noBATˍ0*fh:OPpYp)`OYI`iKJncIY"KM8>g:"Yь4 A /1VGy8-oi:c;P_0螂VA^*%4;0匢 %}|s7ל砓3a*w@k\鯬8~w]PWwL ӷp/"# EbluV\ n]j&:T9nà=C/5$Foqf^4>YJy>2))賾/v>l !D@m 9"6swl{y ~췘~S0 t v[4E~ӋCF@n;?Y?ӜǚMddԳR$3$/VTNoĒk" /MqSl%ZUQiF+aePJC#0Qfj'y23$( |Q+ s0hHSNiњgKz D3.kƮqXݮ_d͵.u XrPJX٘{B y Fm>Rbf 2}jp|ő^PL3imjJAb}dεZoeեƉ3"7_*k9L}R4%h+'NrPP^P@),+(.z;0Uѷ&7|EL&V_Hh` BM2b=v$U}+!ێsSueK2g@H4Jhngrm]7eZVR)Zm1|'( K1!ZH0tt.Y`` o4Il]}r8! 3c khO'Jp% sܭmzy^TP˝֤I>`d [Ь\`-2T˱J(2È,ڢHf RGA]5hwi3Kh(?4(>\fm4 b)Fݗf!QF'w<VN<$ٌ򻠐l{ju%y)\|TNthA(@*sYaN>.[jzM ³.]a iwMO@V+p7F$Wœ9AD>u5dQ%Ѡ$(L:BT*}TʩtZ&Fd2OG~Nu@VV yH8S*y "C%PZGt+5p, DaUJmܝ\-갫{NSKbz2۹Н"tnnj{Za ^c0 _-8u= p3q':WTX]̵xtݓْ Y $*.?i(1mԹ)dhq/&Gh&ag5dUH•VKbO*kpVODjPn NS+H(^Yt'IN1 A1 pux߭uV^8Pm hO!J3T" ,b7I\#if{(lviT-F`M:zZDifF^Fk^Rw `P{>IgPz&&NC8"%zcI'̎ꇈR\NA?G2eHYy)Ď#8S;iuq`uGey*D`:.߁i[x7 /Kkq07J1\fM(%pyG.!e<+? T't2u"Jv'78IGGx w45e*_& h:rm r喭i q>SBJ+66%PM,|~5L{kB!q # qC}6:Pj{gpJ9 /Ao6SSu[H% Vn WV۬yP-IQ#-+M.rdHEm-8kN/g]Fkېwo I z=hk{(Lj84D2nP,S9utD |Cl*^!;}<:mI*pP iþswǦc<=l7@wX)d\a@2gOI̹ */@ौ8FoBq@'"ɺ I  \A<4RO(;e  D ֜4)jFv5@_W4+K, I0Hf)a,xS`g d_W_Uzҟe3IDsڒC l 3gR8hE#)hAq. o$1u_oK,--=xr]M]ln5}g%pj@bq &`mED߿Qxu5;J8 af s,\m} 9죛mXIAX_gL(. c-xm~ueqM>U#53)G/P1?sN[EWVLzA>tӫV@ntq8fǎ ̘W; aiJG7.Ac̩eǤ'cqKP E&UDOg.zI .$=ĵ]芣]yKz*Z o8!͚@ٮ[tD `,%9>cZbL*v7@(1S6^ 7-r{喱YuMGJB,Λ_kziuv? йE=Q X =\xK*%b+[(M[3,S Ab͗\r:7<%X}R4Ltcmj(x:cC|LcD!+WM܊łLǪ̺U9٢nv;B藿ж:bQ6 $eF$gv(9ΗM]s;KeO,[뚯1Μ BAQ _u1&D]3ZKeF4B0Ւ ׯ1pr" MMdWͮaf[&~7q?v}S^Ա*%/ ̇ ȆfaVqlkԀ\d8 L'Am2Dj ۿcuX'dj%b )N>#@8p Mo(ύgol w&jTۈR{˳H;hF f-M'hA>X,Dg`w' )2bN[ 0lLd Rd +5P (IP>5N\sڻ${/8Vjj"8&c$1:ⵎƆ%E-]jYŭQT51:A.ea~e:NM,TߴF=z(UH0g\-M-<\y*.BuTg0AiD>(uN,IS.9I _hH6"YkHz m ޢf4L% JlP~"4/cG<35cdItۢ~̐2w,!h8IXĈ/k2ĂhF5]Z&~ DWY2 wFWҼ0pb-:']M{~kl1)0Kf\(Z (s׵6my Wn"z9(nh(AC;4f_|ۊh~vˆ\D/Э, ^ẃ1FooVCadmeۉ-F9_@xKXR%ƙrRNvi-ė wRJJOHWA`! LgXZ6)()LjU?ex)J<@#Xȗ4y̫ MaZwrV| ulj+/G p]0R-jP4lCU0C.[lT Kj([Qhc3EKZo/Jg|(>J@)4xпa.#E^'yL"'@}b8[EH-X>'ԫ2Q܏`.UnwK: ZJ!ƒ8Y(gLo*TҮ kX.*ok{p蘕)c[O f/J)!˜z::.$uCWI{!G97ؾ`r}ÈFYBѺ:ɤ aVe)$^;6OHÅB΂e俴4,;*c=,}4롳TPqm|q>5Ѷ}M}y6ڐTgA 7v) i Ar|,`_3cFhd04a-F1"]Xg, S+Y.*|/ .FB 407@s|ص|k(@E+ ugD)5Mk>=hE]}z&jXbR/MV+Y zԨ/JԡIoZEXh>joUAY؞+#]S+h& qz ,l%oC2L$-m+e׶BUJRPyB ~%up3Q"(@ =xB뚼BXlzq6evjcP5R/NT7y gVFX2^3f1vO+ 55oɱa B ֏}'-Ї"`S>W㖛53IS[-]5`@Ĥ Iw#|3oE^{Ku8,'!ъygR;4ZXXa-A0N _6Ňe|Єe1A ڊm<1I^R_^Us{zs++mјر2&Pb@f a\ ' lZP"E)R1JN褦af){f:q ,x f-xErjgG_ue"5>2yv!$DWz\)<3Kt7xNE 3|WTD(qhɡ $QU1!5ԥZCil<(T? ; . $tnβS8_~֦ 7q~Ӈ=5.>felīi]łJOF^Ǜu}fiGf@v%:&AaMg}F mSn Xt-JڻU_5M J˒ NNuꛍ7ys*# JT4R1ZMx#4piCVocGImѠռ]92hl藺ܭЪWnL 5& X;߰˝8ݰZb#vvE(q(;b!gV@oqz\N.&(w )j;|뀷/ 2Xlu +piţFsBM[VXak;Leaf>V(ؑ| G_un瀹.R)6B]YB?j9emv~9v?ۊs y:Ahy`kPK3$]i\S^ BStBd@ [|O]RZJ@^}}~[y:ڄ[*UЫ$e>3/zQׇf{3j;F4 Y;3#"x)gAk cx@\oIi_=%џKxis=xjUg۝'hC0YNY[ϯ:GkHWKz;EP_sd-x&/_@ԖnpQՍ 9yT(,\PO^j._ao鮇1g9^cFa]7OI=CYJw쬴۠ ˠA{xa&)P:y}Q9|%ЇcB saW~^a)߿%uѥP3,xT5*?|#1KXWZZ"qgB]KPKf |3>3#$}:}gh`zi @8?1ADg;g~uXaUm7\*R(UkKE)oDS0q*9/Lp>]C:멛ձ5\5)B3lچ|}fݧxxjb bը;Xim~riCrxtXӃ7[r'ȃf!ida5[ahTx B~u@:q+`XОoÈ򀘑ǒUnݹ -1|c&ZFņZV̤5e+%\ ̵:IA0dȘ`I7aW#Ś!.] ȼh=` pacrICgzr>'s<{ L&alMJă"I)VV}Z6èxx O 7ryKs 3wB@T[HE zEH ZĵF/[{UF}@ax8 Xŏ>tw1-ډD`[bE1@)$u(H_G:#l2Bͻ;:iR)W89*}bWΛSqp?bD4.PCbDMGjvSr" ËR`JAԢPWԻ$58D#0m4R2ftnVSV֠ Ҟ^މ/RڜAmfyqNǘmGg7DH!K'S*rXqh…{~Lb,y+& "?+fX @m7 GYӇ>Ӟ`: YU8~Z5sY8ΐ1|)/ILg"|}e0JTgsWmƪ°oVR#^֯y$w8eZd6Ujk@-jƘQ(&~G;;g+B~njE 8'˜y04bxפ ٵ*Jv) w}|1bǭ*e8M#qھӼ+q>а޶t,eVfkpprrκm=JN?Źxq3o:UeM>ԙLC0ֺJ;6k}gzZq14b/z/MrͰ1cQ]3z:E.Q4k?Pf{E݄m? X}^NhiGƒV*Veܕꀀ癱!%Ӷl GkJz}/2%Lt צs!W ԏEEIJIU)8Qτzȶ˰pkNOkШؖҷNaLX3lM+`);(n^HHb$@x:TѹR6!|"EPN45ZҤLj֐.\|IN! 4(J,Rf"ml5)%,.5r"f7K$^'z@H*jܙ}B7%JYj9[p]D#Њ&Pc#)a%gY,3$r6~wbFJě8j6z#Y*ȇ? [KOp i'3R-. ./HUވ]#y0ݧ+Z%= ԥ52xoNM&k-(Sc *ĭ*Y!V_v PXN&^"^by T뺟C^0RU?(Ϳ2ٺ~͚}4V̈vP x8XE+KbJ $_v}M-Rl痖 zJЕvy~,.n$׷jф7s_<9ǧm9,-:,n>g&gƢ3Dh%\L}X?b[@"T]_lB㼖客hG$_^8W<aQrAǀTq5MAzVgQ kH!gIu] pڌxmupu'{ˆG)Ws_4eΛV H[&`$/O MݭDI.^-jŋَ|Y{R6j=>%@~K.8.DykzG%<٨X8:*`8s: +-]\Lh赎dSx^WCM lJ$Lc99[T wհZaa~)eLC܂$c2҇T\>iݼTGSV J7Wom(iNHZXrAJ nvE{/&ٷ9?Rm'f GH*ᄂ#K;xk`tOw9񹪊QX޾ogZ7rط@Icް#k~FwopVѯv͓sr8l}{ђ)6ߍW*6عQ0Azc٨* HlRDʿ-h,ӼPy;tPq7e/V1fJ+ZB iy{O߻߰£f0U%V!ӓ  >H$zd:̔^ Q 1"`֏Q /Ja.3v6;Q4z3Q9'N64E0ayNvmIBa$ *7*3\G4weͦ#:+Bj)9e'ՙsS|=,^50@Z]EMDEF^ 5,i6hl匿?umS[J%|o4sc=c~mu?<zfv"t @So븉vV t`-$u[؄8kT`}QJ"OD*4&&]xѢFO fF\vnUq ,dtRuUSL\ ξ|+˩ ##gnm2Of3L0F>>lR&x bHXj5K4'0eַDTe4!hh.q2/0qqdG2}]UJbN( R垇:C> _Muݚp״eFtgf^~o;аɼEͮ:M.qX}A5TӬԅBޢ~ObFmBQN.DG>ڮ a KR Y$U4͞IҸ˕oļ)z[{;KATtU͇}(QjbMP @&J5ҁHG/Sk(@j:'\v7\FDQ)74FwO/NU۲7SR? F$ALsO&#¹O'5hLo1w : j#l\Q{3$ߣ J!m%niyr :6hN<)/U2DPKj%O-HcYMXvr 6(͍#PCwq+nH.wXLfI^LY* kHhW#n/Es= LTOfnѡ,\kҎ#BL 4a.E9eV =.om¯(ڕ^,{CR(fS۲/˚u5囁t T-'j."zv*Gw<1P (mXkNÉKl9m4G?l-`),]zKEJNt Q60&y3<( G/jڭS؍؁5ZWAi*}\iHCTP='ǡue~陃X`S~~{4e:q̧']I-rg'u %Slmf ej|y)^;:yr0@ Vѓ_/J7#S7r4|xP%Zsc‹K+0ùm5 7}Ӗ c-E'}~m )T'*uMZ%Qve#O5[+(C(Rpmɦ$=c"ad-|KFX 4łݩ_"uO5y TR7R7e#!U$I};@$q'TNBM]6A;<25+f*rһ*pw,54@[ִ&/_=J7tzDԭ}+1GPc~]L, zԎb0DI8?,P'-&m+(;M 8 }9syUo+`zhۉ1U $#܁]Hr^v$h#}82Kf*@%5FENqۤw$si^{y_,֜:XDEI7k&"#%#O1L+˰9i #4t7uX} bDh:v<ݡަ\^Ὣ4"]Ft)@)m4#N"MM 74GNaA^CLgl BtZa_{nkaC3QE?~[+O[m(BT@|B|D4z@eLgF:5pͅzd&iW2j,3=1qMz]q)Q-qb P(G)Gdb@3ncxѰ,Yr~ oʎXe8ܶ52Eѧ;lS2aǎZ&Z^@7m }a<+t*[a^hy0V]]*L}` [FB!*Asrֆj%e[J-#M&BEcU=섹f mΦѨhMa=.U+֔1#4e#I Adw$q󺫶g 8 ~"$D~M1לL2mEy8ں7(˦1,x&; W7}td&Jxx`o+e1X͠ }1Hs9ߦyǼӕZZH׋Y؏=;eQDIe0xg<:x#$*v~J옔K"]*P -]q3-mE*@01QrrMh ܖ4fգvG"SЇq/L9Go`j-(qw?h^*/}tr^2E ]ۙ~9>hu3ʒoskttw{{{%e\$mm:I( 1#NaHr|JAi)pfn\< ۪0FdoqzTܵ9xm,` \$.PeM3LX_H( Y/FWTL:֊6tsU{eic=J֝8rc5uhK8=5O!gi2h^8i N5J[ހhe2vU\W*{L괫h._q >ޡ*8D?KψTBTҠ"]Dnr $=" e]raT*1AT[g"^-wYv!UpCy'UOhyTaiΊkuU{E<ZO_J$rîV8un5 AKK= A ( e硾unYO'^ȼ\E Dr1C;By0+SXv? b +BiOHmؕ!J@ʕc~cI79bȪMںfi0*-f,r(Dҍ,N)PCa["LS=1:>>jp_~-M գ"ܘfͨ˿hrA! NϏG ɏ7vmjoC qﷵWqeûՉ!gg 5[A wi N[hu$g8hN[rZ ,lMwRg%Y/j8YIV2u.6^/Vs{ܔk 仃kߙ .1z 31f@R+|q8@>-g?gX$ZHy02`:{'Mqˤi{źF'Xb#$k#`/JqoE"@WnN+J#Ny{ElzOw9*VH$Xة; Fc% @mQ6d䲦ۙ:[BPV]}YlK?JR-i#iCc,)@ "[fm`fs8yk~4}GOaF .P)nzҿ)7SmnIOYm|RxVՙr%,I:r3̻H"XYooHߩW[6w9ID<ڱ Fͦz۾ - $(x ):j@¦%lRd@;ǣZSeʕpeP*(I"<>^Cx_ bSa.װ=xMlY fZHUU&%5) +f@VOףbbJӧ2Idב5>wV GTD})c Z#-&ƴO a< o;EpVI3e]iouzS|z>ˑy;)gh3ie258bҍ;;&6Si*\eE2ImHU6WӠIdCi1pLGl=mYXSe+IFSWh[L}:2ٍ9LjCQ-8IkTHi7*g*2( 02'8 oWSq;=wu4am$ -bmMXn~yZaJyvSv`CY: xG /]IM6:mt=#SSc@=#n+_Z#Bȇ8z@XD !UiCiA Y-DCS44ҕ $YKldio Y6ۭ݀N$Q]W[^嵸|J_n 'Z_>hEĚTE\4'5Hڵpj ӆ-?{(X!q2h60 JjBkyf_\Y1LP9ȥP*+aJ'8F"my $t53kAa["yYO /< Ps`LG <Krw= 2L3;B- P1J.{ryNl "K@@D(ȏ:m~U5qk61wg@ cpKÿ9o _[`ɳNлf +"x;(A]qFD MʍemL\b` )AS;psniA12'}5 >'}kJ-&hKKQrۖ2A(k2e-K+b72mT2Lʪ[Rڋ@`@ (^@zb=cߣmjO%4g65Oj7JygX,#] ke ݜQ@FWZ3HgҟfGh檞KX_T9GdQE$Q8ՆM ij L1A V#z%jLq!((9`m(Mm7z[5CLTZ O(CIp琌<J4`!֜"H0  [=_q)XD*聩Ůp7h|2D8le9:}!Md$Ŭ]lsCasO~1 Cd'nxɉ]:%oOyPk5rS䢘$ QFBϣ^mZ=6 q(Xp2i"EP"(Ժ, (ABML4ԷQDHcSLx)^FI/i"0_T) i)bӆI0 `R0 + E@B1 "EZ-FI#!~52Uֶ;흳ع Eeɬނ"u4:950lE !_a$+)OX *b(B"" ( *1b Ip@Ƥ "H!t |xL-}z9sN cścclۜVVՑ{X4 1DPŲ1bD7pP{s@yO2`6*yj]5YN#B: ?V7F#N |ӧE-0T$@Q9B( NYtx]dћn>8 "f1X'*h+EEQ"*pCNjxƋPƌ' 5͌nB;hgIL!U SL@!9!^+t "4* h43$E;LmRUTdR(H,,XbQ@X PPR@=C$<&QvP6"?>)h`u0B"' J H( O_^4@{8qCΒt^6לZ1\jL~fNv9\paX3bhR!n;}Äib 5hss^@DdR@A$PbTUEaRJ!*O X)" Fc?GhH yYRZW.ޠHXADSj|Auhs o _Z ǟMOE;+ǂhoK H_9 aHE5D ƴRtګ{8 jH[x>osLpk4z}IxOr^n$!Gܤ];ļhh)DW+:*H(=!(O_S\eɪnDaP¤Y>F'eXx{PFA)N>=V~n˓q$4xVGbl_ɯlipiMߐgf! 0|~w8[UDEcͽyg]ɷKXn 9ym:Vݣ(D V,,;}Gߕcos;:)}Hd&9Ѱ{w;m Xiㅢga6%`V13@іf4w6,KfʋAkMm|*22H4#?ٶ-3%`*0a! ߋ⺞qzYvYt8kn{|GCAvдH o DIGvz\_#WRR2w^UKl 6lyVwp8ÚAȿ{lFg8&^c) PI  "S+&NScOɟrO7ub']?ϓ_g@w['8ujG\@Lk#XZ+TG o#t\ <g/N i޾W ۧe谍DT5 B3N&hLXV2f^;O! #b .DH)"+(XEP2H$I$EFDP&HZ)om&ANەAR j\Xi5pݝ ~y:8.!)gŕF}.,9VNGP=eR9n{=3NyUv@bG VHUX%VJ(UKKKQ rFۧ+jeҸim2Auaneb2|sƴ9~qQKl6]5x'_$$3 i_n|Kq8 @4}KYY.JDnY3(M 67끎iZtРF(,@P^[_v}Uph|T>SWh޳%X8`+ryz{l{V~UW??^h;ߋC2l=;;ͱWȕJcMV,?o&-&^/nɗݴvrv "~;_O'XLp}^a}b"&ѷk؝/~7\]pFω;Ue{Uӭ]0Iߧ5p[!v>xm~e}wg?$̤uzt㢴)0c~ D=.1|;!E~̇kcsl`Ԍj8h2Lu CGu{p&q4X1c6}206^Tp㕻?EŰubS8/Kxn[Q|p9.6 O1QidM{H̄ bdV  jDA OƂp"z?@IzE*h@,$1EOz"D(~1((+NVQM4|5 bHb(/p`" :ł"H+`(.".rԣ9"Siq]q"* .+p t@6QPE]8 Ӥ6s,$ S0 X@R}k &r,$*`Gu<71LQQv¤A Rׁπ"#"H$sE,@S4K 6+TPWEA5h*s l@@P ;yĈϊ8 @I C90SC (@@PЊ> ~ /"+@>%PsALq6Pu8C$Pv".D Td)AAHl > yO VE Gk¥ Ђ)|TT t`0Pnbo8TIӊֈT!*R(,AE1V+z3 Eplo6 шPXPBx wR,E!HAæa@mƥÁR!@FEdT$YEAQ#!b h$8,Cx /"!A=t4`En5@>,S,0+4h Dزzl{gDjGr@xȤNi5` *LjlV AzY=4MTA3B ΢ udX֗u4*좢UփiL>ߡ`w,  "xb'ebD'6Bx>% ȇ[\$D2GB=4:xo=(Ï2AqjH*˹nPD@Õ@<:M(+*f \TӈȀAEdd7p$Ann:4 ) G" (d>n"!])C**͈<#]z1@2O^x*=Aɹ$ &"T@]]IM_HeBD  h UqH;̕@.&HrZI "" oyAb&qvkrbУCmBX j\pKTA uӆxqe)h ,aP@Y'qHH :r7ݍ*]9\D&*td'µH, )!,$ {Y zEMO'NOv{z!ШbȂ+@㊸ 8n{n8XÊxx (tZ j>"gq^D As .pxT{ ٫ƧĤT yjCkͣGNJ +*qv6 0NNC@<8)YEa 4s h=d3"s%htRbH N-HŕСfP ƱiA шTP)֣>yG>u"'OуJt:Jhtw.G{ Q8pv'V;qg= Z]Wj: M*᳎o϶t,pbtuk6=N<ֈW51S ֡yZ.qb)ćF٭G*lTDN?Oiv /"ZP Ml[{Z;(^kU8ӛʻ4KM:2ÃЙT$CKE9:=珢k3JΪj0D5H[Zl}C 8Š+_bȕ!6q3t.ևuskJӈHcfowt <STΚ˧C5]^LTu:Noa8Soֶ 8lՁ3>,tc]j kd6mܼ+"!oi Χ70kKhggYDЂku[&i͚Nl]Eu ɂ:hAqg4: Ϯ~<>FҠ`uQχKT}Ȱe>txԛUMKaQBA8\qwK\J0(N68= CϹ_5 D͎7CN4СUћr&ASFP @ LHB5ߔKY@vp [(|͞A魳pzkz>;CH':FH'HTXt_ *O'3=<&.tDH`I'[*iX}\ș&Q$Kji4 [ ˂€Oe}DN,91b"Wή:^ z18\(F &%&A@!!JV X&LЉn8Ko`tF>6}w"+m\<ъ;.ٶYbI[l͈t,!Ƌd8f"wy,8.ʏ%-=eFnIeD67\.鹖Z~˩0p]0ޫa#3|N(ECpe)j `)(-.r  =mS8"O]6={l9m ,iq9^2q,1_+W))ɜ!VIM|v5&K1VTÖ=U@jtu:q8K%!.BBz 3øUD.H![ f;U5 f lB3tc7EHÄlY\cbq"ļ8<-ˇ{35%@3w:UL &BY mNup6[9GH]-Oܑ9\d@\e2 QZjZcd`AGPVkiΘ$/cpWAg5xs.D-&զ|ٛf9xT+]1 N-qclEPHJ*pQj>m1E .g#Emv6*dLA7*.UOs&YBFYYN}JL"/91vmAT@ l |qe)ayhîV#˕C 0$R TaUiYyb%Bkiɿ& R+6lhYZUi@m6"P*ĺrJ`F0'ku0k˰b3I^TέYX KZ)ÞkB$ XH؁ !lrR$Ձ#! ( ux G:$$_k''aq_jYﯳlVa OE(%HCWdbh scD[LwdL Jq'~Ō՗&Y)ї>2' P2W APhV"@JɋqpڱN#35)0٬s5*Q.SkJ˜KАHfZf\ ½Q\@ZL'^5ٗᜄPf^Z;ǦdƓ0vA2A"kG;^N9{=g4R2TGYXA?)dA~R&! `m2ҞZf1XtO51aX!" R^~F;r,1kd$,A,1k]Z%|@JAL@[N`M9 fnSP7k=VIhbJK˖י͕7(&Y"(̰\PX"? G&NɥR 443s BBW,lZ`F1dCX[&M&ÃneMFDuT<#MʙaZZN"WP1?8I `ӹ.^ҋ>Ni-)lWX)mh!vJQ-{hNHE.Ϊut2 'I NLR*"BjN(AѬU)T̷˱;3Ua=j!Ҽ݌.@Q\~qI ?lBsp *VKP2K -LFp`]R3I-ԥkWAld t]Rl>J漙Zq"^Gۀ<\H+ 4 J,Pt`3M'Zƚ%2mS5H5DES Aw+̔}NlRUt *FtP!Z3eDzmpZpbXCF lqqPq9Bh$" I+"B*epB[D{Dڱ$r!mۤJc uo| dzlj$:?$K%w."a&3ʆoX#E#WtSV,V`Ǟ_=t r$@.iZj.%ee 9(oӧšϼ!yd(>h۟9`m9;l75EPH葫٠(2㖨gʖ.Գj=lgbT24 ֜ʐ+bfjP[Z:qrs4]嬰6@$IFZsqch:G>sg6s8Ct.Nd:ǿ$(yd5I|3bA֔˜P,YdS$ÙzS nO.7%\&Ǫ^Smhnwa SQ6R$QmdU00Vb +.|G5&aq 6$"orq(xy*Fh ='ȝ{EQ42[4Ih8'"H*@|RYِTSZ&sC3!V#=M4!S`` DF Xʅ?54f<6 ,2R-:ȧGVQGp ߷<yh@DJ&~TLjFT) 0$*ӈ6ge)R8b A229'EPYvKD,pL5AA%Vk*8 |>:ZО1&+ی9-Ia΄UgB'* ˂S6xәZ|ͮVB-04y"PxhHҍ0 eTlfOuǩۯu:; D3cmq "BMd(_yW3hܖyn=H9D {7dU8?4 (;QʈTP? )~sbGk~%;8S{ (Td @$ }wo/y'y(P͟ʼn';qGmؾ2/7Mc5UCtz&jgKk(3&agf4\lu&-Sggؖݢ3yJm1 Vy=t&wm?L{dbwi63dU>h vs1 2PwSk9;d6[{q^Y(ߗ]޹X?ӶIAK٫$ߎJ~K2|sy<7i `G}"'V#Nnٓre{w/jmi~5Uz,-M>(M|=߽s.~˫mO8\>DB8}z ҧ9A]M=wS03objgUv%o_p']+@߼;s^krcbZ5Ʒצν%Gc_EzZ+c>鯶/ I/* x`d*oW/;S;@e.N4_ÛɆo 3\vI 4*Wk?!zFg|*並T :]g=oK%X- 'Yeng_]d8===%~[{f){Ȋi,J>04Qp1uk5[t幬juVQiJ)dG3:jX4jŬuilJŒ+]]8C.b-`TDqmJsܺEʱLn VԲVK1(0ThEn4\V-DckH:]julb KiueIj5uVikZem3( mMZVaD*Z5˧N1*ij.[ԵJc̫Z. J#j̵efZ-Qi֮`iSTiij!2Ujff"[p5U)NkFi43N9 ƸTS*k3-kT.beU-Jܦ 1*" lQ--r܍+C,5ㅳjQV-)DEm+"V5KJkZ-+TSne)e Q5RPnqMk5VR֥-LBaj҉eImKUr.KX2 B&B* %TPME@zH(Q0U}\>DJ" PT? EQ}Pg@:U fnd!%d$*<P5 蠈kM@(AA.'xEEw+>&jw *yZ I\VD"H*`ItdYK#PPF@@@ZsDPSB TQ_ϊ-?/*t`X@8I_]?VP]ÁteL\LZ *B;7M@@YdXPӫLd%Ke Pi]c#ƫ%@-ܩ<wK] Le9pjILnPM2 $=b@m} 'kQxTqC:#CLQB(2#|-ybgΧP}uL(^@xRTr{( kz[RU$!"z "X&vZRTAD^ 5E%`rndkv`͊l%BqEwa)z/nysE dz)!!-@hM[y\d2T7u4/+àe# ?F8[̮V,TK`BjB +$ }3lLMhAU:2.t҈:WQ"#P68$$6밞VRTBT#i' !v3 ZEhD:&(6E@3Йg5-1B(b`\`'ؤq!BCIvt6I1#اc5Xa\BjMk3;8@ 1J EI2&^nѧֳ-MBk&fZ̶nUkƈ-}H'&\(qUb H`u0K*_`M 76X! : t y䓠IC ?cڴ\LX [F+*Nӊ+Rn1!È^:#"ـ$)*偖.ܷЁZ4&tGs$BtQ) HŽ(8 9GY^nlM]j1 $ E"wIaY5–:0Zu&MLR0|qzx&cU4^2W-ݦ is%ovH!$+'4T'dmY.]0]h^T5XS(5m|1˥Do`]R@(Y*Q IΈ&vjrŤ&d;4Jíө-8p$*CLReK8.i WXoNiVhLW +WI+88ueE<' $aP4ʊn`!E91@ 1,@*2e+$!a`~^N=Bm)FMt&؝IubX%o3W rxd !?@ɜ!3wVm*T$I>x@u$!׫9<0DgnrܻMwSy RC-I Z4 #F)n&XvՉU趛Shg .7D/dsbcOuj|aK][g]@<$$8CSf \2wݘiÿCfX2wӈ%?*X"_u GO3@Biwi N"Rv܋ `H $$B\Hfm'C)kpʎg+Ʒ7ՙmkᦉ5"T92t"ɏ@fCNB fwN'$ !Mvi(wV̽54\KۺJ@;(Ԑ Vr<S:O1 +-A4$yRN;Q(aWXi @P 2QޖI*IZmd*ݻW\3crMr.F^IWmc++ю%(iJY"!@l P'4R iݰ X|&)Ǖ5GT.X&rji- J_[ANR4׉ddIخ\O.~ rKKbga+ɼ;O̙weX=c뻃-3o~n -6luEax`+.@/2h$@>LxRcH8tί;6߭6@=G}z+{֊~,;bis.q2h,/:FF-d2]kA#e󓣤x<ߘG.Nde4\3JŘW v;O6QP $XZ>ft ݤ0$[DԝeB A9l"bCUtDP3ȀjdA o,A\v89 !7,.@W2 Kȱ/Ύ AP*Bڞx!1dYVqJ}W y.7׭jv9}}}0UVS:YheM:SIF#mS͕0CHYo>m>[V OsOH'f}罳C$,OS/9zP]<ݘ8$Z>=Gm,{6|N}ՅQdQ_NT[A}L6H9XZ4 &k d;CKA$ 72/T%U I*W?I!mS;;ӤcD ch@9Et 0OS'ibw\D_ryէWde/_E}^n;: 1U[ݰ?Fir MR93BNhDUZǴ B )L4~LzQ SyWMg3sQs tjB BoKfCchvx[7t3q+roS{,[,пDϟ{psyJ ټU7prK\znf!1:-C2'v͜/B 0u%sz \Sqy#Q !U**GPʶ%~seŃ{e9v_I%bn6]]3FQN  @`-3uGhu}MUCQ'`QW5?+D%K)p(M!Y1Zia8=KO 1m6|)Q'j!=k5A=m*cvB?h]lR !nxqxYS9`23K礶X ݥ2#vٿY/za?]žv(v Fo`&X!:! 'N gyߩL8i]m#U z"PBq\99ڍYsx˴s! @7r滲Bmʼ^9` wcAWCX^G^BN46"#ڽ:u!#o%UNaTh7vfYCj"$py4 $$E!_-v:cc d<ÅκeƼ?n O,l.~bkq?ܮ#~zPJkmBiyMIƆ'=U/lz?PgWlGߖ1X3Cv 5ud/߫X.V%~vƒSsٯHllޅ^z$$u "?q7|Eln.'uOO?.[K<ȷx=[/6<읨"Gg,㺼~ҡP5<~0} Oͱ\\#?<DSټg_n/jw_t_)3Vv޷9LTo޻Mŏ#2Ǯqj{Ҍ*_5p~ B]6l&YOP6|?f 1e8!`Pe].**,p2,b_ir`ⷬ9ˢol"wYdxϪuݱK9%n#Y/&ɛ `klw7?[˥HuW>]oSdIٹe[$o Wu" uDM{/螓w!!}WEiaݪV\p-'qkIz5@NV"4A-SP>UmA.a2Ɵ@w*K\][iI;m=puVY"SVO3].E8I Ԍp|q# !7wnݬ>1?X,X),+Pje!eL}֪x|sWs-7o)2d UP\2%7N/ZZByu6װX/ ulKxep^OS X@PА_蹗^mE[ G:䢊p"#q0s'/b*RUI}vfPAxw)ܥ*H(#oeoݰ5ݎ0;{+WjRbՀ[xVb}GxP|!C $v ~s7u4-k4YetF0WW>^az%}0< V^鳍9 kmE%yTदAiڅ믖#`ACv#``Kv\\ykCYvM:cbF׾"bjjzmޙ/Qh(Lzya<.ջ%!v:KQ[R\cn-[{tLo7,fn~rR1ߙ )x@ \#F9 2M)Irq$a74udtFRzڜkh07 "u4eg4 &k^[N-Z-4LCi岕k 29I꠾] *Lzjds,,d$FQR'Pe *;C}Yl3>u^I_[ƑcqZš{6bsyK XI`$@ApG@+р[ixɫkc}ͪA&{.-UP5g/Ϟ `!!OFU*x\Bǵ\>P/67y ݶHcM""")އܪp,8tU E^E7VmWϪ᷀;|]2XR}yݲ[D*kq$0*jD)Xx\\=M̉5mʉN2w6mXsF0FՈԥ#&pMYyh6iBށ Yᦻ`9I5]ZC tj,OttbM.w J,p8y.Ko-;BB2U5KkMС&r)Яd")?ޤ! H,d,_4)@P,@ ΀@B Wbj@$<°>diyPVwt$(5W`"u6P]؂Zc$E #B,NW7C8>+7<: * pˈUM~/"еgnsQJ2y}F tK"R;5p&0thT*U1@9܈mAR$wyKkh\[1|xS& Wª& !j4.VDIMMiQr[R٭妉T3 QPPdDj@C43.PnliRp쀡r$:]fS@w*! DNh6"7:;J?8QE3_Gq0ED%Ii9Ż0.B.+ W2CR+MvKpJME@h(U;FyA-6jYBFR4#L4==Nvĉk3n54>* 't 5aj4TP gaA_m;/H_L&(Z! @Z%`YusmuKmqn6 Yr[IX{' L(@f;]Dܖ$쎨Kنy%ÉiYY `+TutR4ȒK!tEd`mz-&Зi $V`#a V(֚p&h ']=kx8߰#gid#(/u1Edky(eӆ4ԦgK!f &i'2:r΅Lo󚔮%)" xXRR()& ˘ E afvefX 34#$zU隰Iv4 5YJk \\2'!\*C{9ϠWfJ9 w9A@6(9@O_kY\ae"ye!d) 6f5G`}1n9XLV!겸F\y$H+ c#uTj% E\$pEkq$J~P ؉o("a;cL5:r =KuֺZW( 6Cnb(1"lEnKb~+TP1¤\e-w]W[1/>V!IOa;2mO Zr:N";9~ *ӭӋȯc({&(Q!I\*5T nݣD9b-;)tT&tbUH*4,J i7{|(=Qmp0fQJYH5vsk2Hq%F @b1UYSVH`4^$E`rHE+'@xBHTŪ2!mxtxjMT;ܕw\l*Zȶ*,DYCPP+ XU 69J=(! `ᔣ?+T`|nZؙ:RI: ;N+R&7of2Wif楶f7؍]bQpLx}r.jIb@8k:2ocf<0'7+Y,ss MN.{)z#y TzDōc<%eqB|tB*3IQHF&LΥNʴ*TiU gR aK&Ъ^傪~wTݐ<&fFX4`Fr!LPFsUEC%`u$g.S2J'%HDRI@#p%,h(sVݒMjմ1$bf1\;m㬠Q0e13Xp4Q@U(t Eb\9K"v( J:w$xRā_,U:dgy J:τӫP%2VpbJ<N9֨z̢ZVUah;%7ݤOB,"ДJ#jMQs:g$"VUqߜq7bf!OK_:L8FBz!^@/ejѦ@B-LLy6)-V lADHZ Jpzvm&Dsw^oc?64J:xZPxʇĤ؝Pl=~ Q+'A&[0 GJnDYh 6hF8!Ǚ2f9:D cH wy-+YG |J2с$!%,34Y)dCv,?7>,<`m_Mg69 &a|%P'x:=9yu巸!StY~jZQd0'J{Urv  p0!@ep61-3arMeX"(Ci5K\WD5PIMI8ĦZ}J;DQ ?g*,((j{N͌yDk3D,U… _x|!಺ֶ @2suCS:Rc&CIMH9L4]:w͙ﱦޚ\+BʩӘauT4Nm`*]ƪ\'`sXau)iO"q}grjv\sC`OアZfl&ޞ q\iXjh9 ĸ܊`ʳǥ/ I-"1MIZ~]q3IcBjxsZe =A9tUy%\'Ozr9`8LBɖMⅬ瘪JTn e:l*M(^YtÀpܾ\M#쮠g<[-J?;4Ckw2dpMA{]i4crǩbr|N$kR ](.7F)Mit0'u+"zui) N˥g!ZNTF: A\W|evH30ɯJWՉ( Z˫„Jvݛێ+^y$񳆐4df\Klb'9=tE82X=,PJP/=QuWM+oiT(jm?x颌@mF󗠔Xni%R%=6i X%9v 8006kQjPNU TwAd沢5a&I]]XB1|jts5@MONdԂ̢0DmAbHt]4 _gHV<&(东&4wEVg67׷ 0 Foq*ЮC q4e ✹duT4e1#F8[. $+iKŵdᰵ q0C3"Jn$@F!dFI:cGkxcb4,wn3Nu߬ !FDY%R1r;cبQ\@4ex2I׫H/5)A$CcM"pF6keTlj[ 7?*TX`5:W.T"Ĥ9NǞ=JHF]wd]dX`edUoeќ'V6<+,mno"4J |tsWTcמ;=)y GX Tj E4$ΞcF7_ٺz{:օ˥o#i@yvмn|Bgo`gÔd]ٔd5gleuZXM'&mŘ\Q-xM{it%vjw5*&l40S@<8!r预's&r?kj3L'{oAtP';i9f͐Nso(ٿ5)m˾GQ›CKC>=ew/n:_8Ѐ9X;)Y5c*ٚ+mWpź H@gNn}Wt}Fi[1J#rP\X9M ݨ<|ڴɾfxIi펹 %fFm¨Zӗ=\1 (dɚBfZ)C{KF-dii8OS/3d`c< Q$̸{e#D_4_3dz/$X zgjluQFί{r]K_k9D0F_r3@Cy-Jӷ/(q,6 ȾR!T0Aֲvs_sGlȓ4KJvКmb=$M5Iyf2c"yeF6} *f˘9c>p]F~C&_Oirr{eM)bpEyB,cP@_>!08$Wx#Jb&:F"gB691'rRh*,J2 727j5Bk=l4qRteUd<|D-(€nCJe< _ءZ6 .Z*Ox<^jJmHB 7{}=7t>ou%w6o۫{ԡhxqr ׻:n63敧0uOy , Η FdfX a:jsLVUT9@JAGIF- UQite`X ^@OI]?IIL2Een՚4 !UD$uL8N荡j*r9<)b&GA0E֭jI1lƸH]. '2g*ޢIхx1J,WWWHi\/UA*$SKbO!xIoK{ŏ<ݏ˫l[[k1#O88y{͜QСvuҊ}m ߖtلxM2`G։m`P7%`` 8 )hc9ML4 S@Q}$eQe! 송0vGB0pGtE)+ĕ$MYtoɳ)X! nG;6^?L+&jvh6a/*CNm?}2/(AV*[pfcH_W4NJǪsK}? /+u%^, [;wgSq9kփ'tݥHUw[Y+T1vO~vFK526>q=O٪,z ی~7O{kɽ-շpغdmy')RxElڋ; ?olp\S^7Lպ)ki$_' |ޟ8+[rx?cs|ڞE_ a&qm +װ|<qv~t<J嫵{<\oTQGɫߥL*mw֎Z#4f7 :}6Q)9uLl\~'GOs{OQvi"};ZP+l"!U闏+LR x 6r((OE9;q5Gaj/|s,SBɬz:˽27WkB_/ Ƚj8t Fz}dq<Ƌg}CW跽;6JFm%K ?te?{8(&["ᮻ_^\{/ IQ7&]kݭvfޛF9%Y] gqzii[EU?>6͓p zu8ɚn7Wo3z}GSG^]%eZTPT,n\[Ծ}zqNK^_ SFe]䦦)K kXB_nUt[)7g~%?p>껯'OjZo'w ȇS}͡R ewQ p>|@>4 *xh` 8 gG$E AG`'n"D|Gmϥz*  辊mbT+tt"!hu(" DT$~Cf⣖p! EW6އ$Έd=UTW@΄)"(q@l@h&I^SHPQ ǡU0hƄՕ_8@Y͇H g;۳.k,h]KƱcE+'`3l]qR|nb=6{El?s&r"5E\/󳯰~NϨ|}4ϻ~k#1y}10A݊p*Pw / s!~|}_v|G  W]'ͽDyYB-QLgЀtOeOz|oO 3@t##r2anokt: o4<.]U=1}u *wmhqtB|yxo, ոn3'k]w]/\5LlF{qZ&+}/+#BH֞.Usϊ8Zg|D/\j-p?zr~H:7pV]њKZ޻;{yHݼ*YvG$W/cCoihK[Ss 5XO}Wq}\~SZ^L6Ӿ Ln[ntTq*">w*Gg򲯽];0WSj8(տ K~ޑMUczc}X:Te%]Cʳz\N)5l)ׅKpx}\7lg_yDkL3OS<M_keKܚEJƩ{ d1~L1|'cSǗSע{9=KUM0po4zZ5N)  T jI[ yx=0#S%O\5-KY8eK%6X q.<>evJ( 1!;E~o=|Mj"bKJN`5mb1 y(t35E/h' Ē.Z' eȒOcUN߼zmazrj=u_3ɷW[/9?b0??اzy,kܿ+}ܕKw~@C^Rw4"}ן>}]9YZ>o;^{Y$V6s/ۇ.Uƭjy;;_ui!ž 2¡POo^N{d<l'괲цH@f"z}߉h/4iOЊxmO|E` "+@o  !Q(?^+a8?/c)A@ Q_hiRk.H #|؈ !3:||1 D~$CЊ84c#Ƞz "<<|ϪxJ"bH/ ~\MH|(*<nyE_mxzOK@DCЀDTΈ( DL: AEImCe|UKHԂs?;5 kĐPm(OM~DU@@TOYN:Z _TLC& H?`@ц8 **j(^Mtm0@]pÇJgۡ?'-xx$q)a 6J Y%K0a-::|/WA79\s+;Eo{e#Ij ~9/29Hj0 LFw6؄EF 7) kf@v=zR~#2?_4qameu8wg<ڎ wfso+֪Ou ˺wNB$\=ui_ށc#6.ZV f^ymZ @35?pɍ+#GĪ m0;P'ziaW2>|)"K5@rݸv;6_Js8%7cj8;zDߚG뻥qM <ܔ|ùߡpx^"hK7`C µO3>~7W8<0< dd(R$]LڲY}~0YCgA;PzB%F'yN1+ᐥ7}+XTNÕ/f%>1/4BӜA>tLXD!T?] (c^d#/J!_ݜ 9%.!$TMH4EW_%۲0"L3]/&J]6H^yO\d 旨j@LQ,10<^a! 2)>b'̩< /0%-`_yxxA3ۈaiMW.i}i^k(?피icu6O߷p81_Σ;~0nS˺`}^|˫oK4'{VwXkUSYm͌ڱm=xΉ~s`:/îQ Y$b z9k<۔Μ,GsqN'hE081 8W)s:6*_˥E_5"c ;۩LF=OM5"+p PQAABE~NLU&(Sl?Gi,:tψ?)+>/t~+վBNڪ(XPK)ocێ9/ O@AC-~C̆`,@?#~!&ܸ&6`RaY+hbQuP;+,1g_s"B .tA$(5HE, TYܖkYO9š#Ѹ1`ml@C-A_]R3oި m'J .0Ma,*]-Sh.y#8v&C6c# ܄ \FRŻK$ڬ atrKv SJF&s260+51H/Y ˌ3fYY$%mr̆Dl5salG*F `JeMCSt hyL>K`XƱ`U"IŝvíEEY7j"HB'=%.Fxf% lZZ& ˜IyR$tbo6䕢gkq3r؞w5{o2?euȎFalp8xW+{7oXZO못Soޟb5s=$7*';ጢl@P9"x[ 0x0;PjMhQBCGJ-@Ӌb2 E4*Sݣ_>1 {rt@V L-~)cbԇm*_~{f잪Qv {(Ւ>a"BjN,PGztE%P`b@1EQ|W4a͡e@~ 66qrJg@pDt`7Eq^ωH};쿣H8+snc *:_} d?n P{)w~VN0QOЗkg[ 0O[OO*X3 VŐލ@Bsr)ծo#ܨAG4~"/;Q=ukt:`&^0CįAPBXa*|Aއ 7b$7wa)=.,k]7YƲ.[Hw<]%Xr)"P :!}ơ9V~ LlZiI=F$baQe??~J '|tARuԵ (FqLsS9Xo/?{0i8nJꏶǒ%{[SQu1~X6_k뤼D(" 9I19'&8v<~`(̛Kom;lwV j7yQ¼.)?4 M$ 3' lpRw XFe]/pΝ?5ZF'^lx\]V,!s F;SQ# J1g3q CHZCzq/Q">ܑ>}=sT8YsSৡPHt}I$ Bm(j4©&Hƌ*o@2}e cuPIy'"Q%uiKF7@T%x}#/{}B { kmw5!dKEjy,JP8!# A䍀E6Y ( AlQB,bċ29@!}@[Eؚy&1M{p5.gg݂w8یW~Vsy?}z~a'۹SHRfo|0\>zciώZ%JvLx M1h|y̠Fd},wJ`zB|[~&]#eOiN9P.nk'mW|abv3gudkoS A=}wnz|.o7,&B3>%`}*bB$L׀DszPS6QD Oe˼`h\5F`!?:zؾ2*>r2與Im31,ndGDk>(tYǴV4: K筏s&X* }7vz{H.N%!uөW (@G/8&G=*hߡ-pYFP2 5h-PS4џH txDUMoH̙Q]wxɣ#Wh؍Oc?>Y `aurgR=ӋO&|1e,U3i;;}KEJfK^mUY[ls#5&~U&N;P4bZ'n-fViP<*+JX%8 ᷱ8qKȊ6 |="`9&Z-IeT(a*%/HZ2pkV 3Ϋ0nQWwL'D(Mgkg@أ&kŶ4e4-$꒱+aKsׄRXS_Da0̳[8~@%(@@؁a+p1˃Moťc:x-J6^60Nk+܊b⮚tYl*qޓx֏Vz{©IxIPnX5ADʒ·s7 "^0* у퀈 5 д㉫tɈwխy7ur4+,:{Pv9hE LqAp "t*!sBZe!tGCw6DPq%"/ DArE*)ta@<8. AM*`pb(ˈgx'w-^o=Q@YNF.Htm`/Mݷ(!@(? @פ(LӔdwUJ$Oxu~c RK%_Ǎ&wk6eHئyY])[XS0G>M>۰xK3@!t,NAS&];lf/C+.* %,Du>Sױ|Ar3> ]Jʒ%ᖽͽ9h#VFQCM!Piq%EC] 3|W9X{4#\^p1Vʣ[>O{$rjTQ4*ǏFv[jCz̠wҘ,fZUoiek zIVJŬmlcg%S$&ŭY4k9C9PWTY!z5n8]=q?wÆj]-SOW 52:\UZ'9Aie<}V@*7Yĸ ׂ2B@DUSP!졥?ť~O l&+ ݝBjִPBB=e*Z #hȚD7(LDQS൑@_mY I)g{`C}Zڠ`5 .ڀw[WE;LԊI|P\qPm["RRDPL=тvuS4A_Ɋhh hDVh@+&Ae0Vcs /?E'-#3 }oеf%~ |dƇ9zc3;xF UP$6`ܘD,B /[&zӤ3 &[CG/U#?QNvyYԵ(11{sjE5&UNJKӫ l9czdLLd/[, ]inίO^ߡ"<ԟ0C2c =\VC8 bYTRU<\3epg> y'!/Gڑx,oDHƏw\tU\@ /5 _5cE۝h5zR3$1/1FY99ifI'ƙ^_knr2ȹ `E#h±(lqdT3& $HI"%n@!P3 !U td4a6oNnqy&@q׮zƁT[ȝޥP_U?QU"J!qbcݻ ffI42`Й J8gVdN Gé%)c\mjJDߘrޖ5(7GJ:$sfYi-2p41 A"gRcr  rWC6Ȕ}`ƥ)"ԆO °pB:2a8|Y^h 96Pt0( z[$[hi s Ljh2- fM𓬽YR>^{AQWܝVDxX!z i vS .3%&Ҁ#>ԴTexN?~OmHLswd]O\U!ON_۬դwiwTBʲ.I]hLz.o4ޔtPv!)~7'Kӌ&QÁ ⌸L8hK~f…_&*ݘ*,*o"kTкR뤝F4lvh!^{j`Ҕ9+/wQi^CnQ *J#/.ĕ.kAPQ(J 'i\zhj4]""iمֹI4@7&³|$%De>2C~p+VIx B*8I# %ASivPFϩu8n,(|:)zu8cD9?ā1ЁR_Й7F)鸤5-iZj}tk];${ |jMcF󝈣4k[he3~<Mǃ¬=l!z/\\[i{/j?sN :FGt u{ ,wQMƫvoOdg^л kmS~/S Uh$559;l̴Cϸg'aV뼳H"3~ߖoqg'D"=玦g48ְ~YcAiaC}{{)YkI'Uu/Η*c=/GeI*|7=68e/ζQWg ǵ@? "iD9QΊIB!_WX҇"*{x>"`քJj^β-ҊZGܦ ny^p g0͢\4J pZ#|؜Q_>WGɨxWA()sRgC[O!qTE4G1do\ǿ"Dx810"Z$Kٴx=xj>+Aa| 12d\ ?Ey[V_=!ckV{5Eo=!4:m'kh ]ߑ'{foWm:2ΝO>ʊb5!lmQTDOp? |y98-OB(.)tUou( hH8s?7^_`(憜)`cCdPƈ*_FK Tִ?`"T#`"MG-v'XbBQN>0~/Eeoh!G:rV,t$8i؉L<>̰09):@'!0dV!jdg&ʋ.Y\U,PR 1:UF$lN( _簈ǎS)B7CRAx$zH!lO;.m *:>k,_9ex?gϜ *.pam\r81eY&FXFPa,u4zx*_nPvݿi]6/=GDE?"/xH;P:R+FZSήu]O!;aw1$&˃MCSΞw=|?[ض+$TYTH5đAoqbԾ}dSQϖUcj .*u`V퇾FG+~ghM$3|)WşӏhOACJqNIF'})NAԼlh 'SH:j)̯~*0eQ?J #*$bv/T-i^"qZijZ oF{ͬOar31w]JjE)L <:'Kr$sގra ±Ϲ+Cu(Imc{,?'YBY.ӂ4\2FBmqE{?~:J@I1z+z<=?ZٲXGgĝЁB+)?/{Z|l5ht6{ѸD3QqS?w}/mo<# ~$WL˧OM[>ђ@=L8֐DP-F>xq&Т]uD=\WR}E1] QE<?>&}k旞Ɇ;[y?3fw{T #d Σκ5`t;(O{L /aCrcf;!rCPd:_3yW;>'Z*A윢sYno[ֻJ'܍1na:0E 1Պ ĉk=?s JaW{37>wIbv)v>_Uy+MO0CtQuPYS` DL"$TfƟ歼dƒr{g*Cʖ ,`_NMb{¢HO!5bG9pHԶEHb Yoj$ &t|2/a&ghM`?u땑UǸ7Ƚ}~ou2aUdEYv2Vgpȫ x珁Պz\=@-߫8l79c]̎ə!5۳"U)Q.EŲ&0;Ͷ3 xCw^L@C/q.p=$y\!ފ Rv F  BJ=E'[ykb:,Gt_U %?Tg1)3P8zp 2;5$=՞؁_}QEʫo)RDAy9$%ֱImyP#"?h{ ~WP~CFnz%i@_  ڃ vtVy?H ή琂t9Z~zJ nMx90ӱW}DuCWŸyj&kH"aNeV[ݠ>0r$wk/*;I#o|>e}TPt'^,ʬ8ZX~%UK6(i19jb/Uo V=JBD X!vyF">TRdGevz*Uן&A~Ercl/GrGvX b]RMqw;PW*?C7uC BeD2Sz:(Gc_cA Ǣf_ Ze)K6PzV)OU578.Vk[{U؈F(-S&{fhG0eG]SCG9QO8W;)Ĕʶ20J5DEѷvw=W6iAAYsb?rxNxZ_K~{WnĐ~R$xyD +y-ΥӵS#^Gv.}v?8+ETX W #D+Y@ϼ9i_,Q>kl*LDF+\Ċ$tNC ӵNw&Wt5{HŬYEV1e\5tUj&V[nGF:T\ש;uc&0}C*S$`ITX6* ) FT1:j!ŕa$_i(^W_?75 /mc#Wߩޕ?=MO{fz,9D}+l.sѭp<=8<2 Bk;۝ȴB]: :lLˋ}z V}.e'WU۽PsZJx`߱{;3-*y-Ttz4"\Ω'z>)K;##,1>x9/.>56:;AOԂ`).;:P9O[~<n}G Q׎(RũǀTdk`B={5WD^p^'d3JNK>3Ygb}ovwYfK {۲ۢbe1G\-WW3+x'0[0' <.rĐHe3 K/Ӎ<$IwD{.Neo=8Q{Jrb@Cs?1NxӶդP{-<Pl\0bh=__< 𜊮 Yr=Iq/A^k~ w`p^% T!ApLxJ 4dPz!]ge!i!sh<-Q=}$58Aޟ*!\ڋ_K(de1x ĖlcB|/V{U}^:Fy/Dq{ػ^kkuff8‹Qntm%Mw q="^g\op"5iwjpZ'Ӵ'fpOMj6?FN~ϏCB[oWEoi0BV 6S6Y$8Yqz$gE~fR_!׾eT'{~>imÜ]lN,`Br靸|S%ٓUCm"5`Fyik2poL쬜XolJ%_f5RwVr>y0ψr{3ĬXٿUۗa+ՈpK߳ziZmܒ,99t׈wNyu\#]jmǣoS^e%3sZm-O,(fDK$]㕧)xءQ6n6b&CSїm zt1io [ISTlꨫ2L͹I3ӋDVao)oYiG]Jsnԧn+2'o]MwA,.%رo"d\-`&b3T^Pܘ~e x0ph>p߾NC?Ϗ7]eo@B wwAŲwfŞtlP~VyEzKfD& v96N )R]Ձ$qq=9-:n&4&E&d8֡-$XIz=D$xf/VBlE"1KmL &3NziX.E8 ٹa"\5D-e>0+0˥V2G8AM`D,$3ZtCB!d$ AJ0uD9d7k 1\ :i-gQE RPqwevd6#087ԜXPS&U8B}$ 3&LKhgNJ.[icOml*ZqBFѮ$E8eeXxa&T@4}^Kll>3%V@.-evuql4$]~}~#/s]urp:( ,<TD Ud"2,E U" "Z8]Q?״,Kܶ=eIT\k[z{ g c&xJ@{{R2[Q*"j'W\$ |>xܒ1?Nj '{v.vtf;1TZjJayk'/Pf0 W:9t&Ɂ E$$Z>?^+[5Q\ CPb}}}w/gE',)Fӭd DrrR^ ?b u^pFW# $!c4k64aN\Z4ڕ|~y~M@[%6| / D"Yhn'g4"Aܤ6 |Sn[lfe/^W-& /xVX~vGAz=gQ-[v9M+/xxK׸ sw d? WPW{\V(2g|g5/Pw*uKsU20E 1O<I&H@rf𫦚yy1? ;Jzq9?mJ24=fdޣƁ[y8sk )>d @mę-DŶa{^]SP)y*# BJU@P"") Y"3bU4[@!/dN*fB?hu}$g&yoFX}&ۓ=5ڣ~^/s}|?tݵ}lL)Ȁv% c_ޢ( OI!vjPLQ?~o^*;ie ppX9`M.Av?R"lOCwIc우i͈.3#;?I{ߥ˓?$HBy} voG>QGY_vY0ۿSwnԜq>gӵzB(m,m4!udoQ3Ky^6B/W5yLN紟 Ջ 薧pEL/7BSL q7pN&u`uKGWs*lxq:/yUJjxy@2 =V`\߂enT2Bٽ"^ Є ~ GjzE-Jh%:kwIP]U7~czhVs>Pk *r`Z "H,]+=Gn2eM~傊O_\)zF?c>ObrKsNμ<'nkB.F,]$DU`i& E XDIPAQF,?vS^>vX\j DMXM*o<<۫f e_DsӦк~̒|L0൑_ )9>ݙ2R/dG.lD9jPþ4m~ϗÌ_>mCvR)ξzϞ=wQi3UEDžtg5Bli2HޕwKVѓ%Gjõzhw ;5Qy5[kl)ٵҴ{"8*yOgsCRo/B` Q¹1ε'nKTf; ;c}I\yAWr72 "2T-nygۣ^Ox>v!$>5˚=qvFm#`9\oC|'iCk#i5Gi~DںnSO&?f!AEE mAX[eeg5$ *e;|mUPￓۅy?c_=2d ¶y`<$#e&C 6'NϠAGtOj K!:?C`$ET;5 5>$ЎtM`'Ssh߸Z;Jz3!S! 9E~DKYy>lOp2\ }*zEvNdVI,]igֱhT=?V(~??>;!X@ukFBjZ֤Og@zlw.΢=$t0gGÀ&)$93B%pdAH ⋘1^]˹C<뷥sn 0~{Zsqx] RkO=zTIZ x4Z \ ҍ#F){Q٨׹ J2zit}=8¬P nT`Pɐ AthN P^<&a$CXM%F*MY@ajFPd+ZˣWEܗ[ey8|W&&b]d1O_&؊ƻsdI{kNbSu$[R^_%q2 q';gٵclA V1^3_|QNWuMeQ0[WrM;;t Ep4@3@#)=y[)+! ^D:D>v1IA5VOFV;KhtPNݝvߋ3kDLj\N[qyDfu0s͑A W_  06x9(A""zV]ltF.d7g|_zzP@L;WwHWYh؄،QE>ؾBy'_Uzcx,> (>v-?}7dH>:-q;?a_>41Dwg@?vyG r+H|>rCx:0^ϯ-/okm5i>&@ZLîlOcLL=YEJZ92y A܌59Ow4S!sK?U};3ʑ4̒čL̚)o p٥Rcq y<9*qwv?=Ua4ukS}z9E!PgjU- rJٿ8P3`tqK߉hhObyϪcb4  J養baC1j=開֩0٩"(c+85fSѳ>;m0̰A@F [!Խ6H MF:GzfɜZ7`b۔/cwx!!,$k#q.(ܲd'1 ‵Oz5$Sab=_K56ed)ȣEN@tG9 x-"qo֏o e˳gw<%ŷGj a(4I~f\|r=qݷ?2: ym*@q]\ .}9:fܧ$RI(V:]x-"wR[ w:̢}DH53k5-'v.>;9#:f!lg)A$<-SsS& K$>}q?W;u| C֕D\ gmdTKּQ.bMB` 9PaD.\ H<װKqڧU:/3Y*MR[NdJ0x~xW{<8ޑ1B6s%Exރ5ȵIl/YzHzHh~sugGb|_,Qj5A])+JT`.j>DAϷήshfk%DVṈ}VZS{YQ!q qnq2,+ggcW*GѽX2{GO=פ6+?ЭZ=W/@_&=K飦z@cE'Evr^K!8}&VODYƅI;->ƒ[ a13>G~|';4=/NQU:1aʃCҟO:RYa9)qڽ=3;XIIgnaE~~שPתeGD;oy鹞#C?_55xC[B)Pv67=} xُF x+>+-= mT9~{y .؀q Qp|nu* 3yχzҲzz@PYD~)/䳖`Cxn#(=$l&̖0DAuRC!OQaȥxAh]^;5ȟ@[7/*'|u6Cu0W>Ŵҗ4.ϡ2TпY7͹:NE~m}R5>oZҷ;v.{ "Hͳn Q{u-Oj^aFۺ ?{* ~ȷn z(b|5cz.f;^6u} ǵl8rK,#>qv7V\Dc*QfO+ݷyv9J RP#!XGcݶB:FQ cR)}p$> ?_6I% #ڗ2D]s W-f >=+%VQ5&Y]L3nqgXtuN)"E"A=RP(ezI#v2|~ϟz;Wӝŷ}{OE|e2Uv2"|hd6G-ݳ1)RJp,RcH 8A`.4Ɏ:Vh\ԈSCw(wszw~"`wu.ǨiY6Yo6.Otތ92i-=/k@ Is.Ϊo×Vx7"Px' V;:/"@!y.d!H bd,6$[u#dsbX,?V Z]lY<[.c܅86>/[){~˖ƚ/|^Z eܤxEa0+{/p/Ax^$}[Wztvl}1{s4ȥK#?;TM *X粷9}U?F`[EТqdck!g߭\gff$[zfjz? c}GwT3ҝsHtdl\$Ǡo/QIAΐeI[:nrIJfJBoTGBzm= d+mlC9AĿnalA&߳T^rAbbKޠsШNw!jvmnޣ#ó4k%^FBٰme`xm)TSG1^{::s]M [բU/Թ 5pZ'rv|ɋkB{ Bb=?K!vn殕^nO_0z:["| ~SĜI> H>몒[@>$Ir~bi SV1ҩM_lXuc꿷Ouo˰֦sA5UllDN׼=}o}ƃem6Pឃv;9lRʺw_`g2 d~TFaY9m͠Yַ~ڦώ*F.vߧfTķd`͋{ͷeAɊ<:M 8Z5\JP ˤvc3q9̋o7Oʴ4S }pJ)&1w%9,eoDmQ5bW. D<_UD9COV4?%φie+_駚si"1HV~%ߊ94SԣKq*L欆F;?|n^yOOv{7HWڡ+A68my &_W*u/TrNif 3't&!Anl^݄Lx'L.iA媸MCpzM9.*cdqyΗdqUcջvCA\ӣޅAA ÇLN36 J?W$| ؟´T'>WBSE?ۖ7䨭᜘ q(>eB6>fp~pW=Fo+ǘ6^|?^ß o Ub=1R8~^Aw(|WW7OηW}}6ƝWD4lZ`kCg_jjw~,FLbѤ)n?5R"f}qtkj^bY+S,\ta"i`~ pQ+~;ښpx9vyE[(;hufg+]y *e͑  [z[1vw * ϤQddAHxĉvB9=(h7<)) 12k 'ƫ:`M\&<ҵT$ۄ)/+i SD+&6̰Æ V ~~F}sm!U"2%rZD\*ҦD(jBHL"bP1RIKE 3ؒ4[A?<B"q$ܘ_fA> W.>ź˦.&_)7CL+L~6BiDcB饴h"Z<u3\ڐ p (xUPb+ Z]? H\460.(Bb+E- $wyMmvFj2uEg'6=9jh @kjjOhw=E{㋸6߄*]'A_ʌ`FdWr{52i@dL'}܎% *ߋ @g۱i3o|OghOVlH&e@m0ʙSn bϫ ҳj V(f-)Li@~YpQXkurJ,s@Jp4WbB,& 0 ל #]2ɄÞ0&Dp (}3nҁ`^U%k$ 4sM8dC !j.}x8->UD[5-Aߗ<>˞r~`1>'a w HÐ`ȃšc)[n 2!jר4$M5.U%]F]ǎG3E G;Jrɔ05[tЋn ӵHS u T"dS%uYSK+G]%Loj8 $吓 ia@& aHb&(1Ub[6MVQǝhdTbK,*OCyinkP PQ;Gb; K* jS9%䀆k a:J$& Ғ$gC_褪OY}sjpTPPXY`HCGĪKH!0@ZSZzriA Be~v5NUcDb}٬|oJn)D..h>{ ǜ+}&.IiQ'20|p󆷌#Nsoaa20PFK8%pKzK/ABM,Cգo=R6}vɿ{o89+6su%GI)qS=՚C11 ^ܸvFE5ͱ HeVWt]0air53a c2IN)oV?N_d<❻ӧ)! Y!"}Z*e:P/AFiDi 95y$ D{$>meS:&`"=0 #@xPJ33II|OlÁ!1Bw쿮&̑z_ dCέ_dŰ̴3 t };Bf.؁U DQKS=@@1qH XJmfX V(1]j]}ݳ^}P3uݨ Etz5yI0j;0kF*I >[o/#Oc/m7,&\F-ܵ~/"< @<4B U谪T(?;g`y?ޫ\nn>e! G'SJ;h P>u|ي´dW'F5OI< -!AO-yW~ ڿx)?#1 HeТ5z FdQ4 &p%2I(A{( ci8a./ ʁz炖q␿CE;R08T{ǨOaNLN $OAE)*l,@# \K"ƘR*b 8 CVJ¸ F+l v(ܟo:wJiBiL7&兘1ACg-l' wS"WJ}5q<} 0B2=/S fRp`ohqFȀJh2V,u-³{D (YFnFF$J)6% Wh/7o&qN}Ib*GFj&њUSlArϕ:ad3;gty]sM~ɛlMM>rL"ѡjΤb{#Fx|YTV1<| VИ̦8$6ZEVꕂ1*QLJ  R$KBEy'q+\k}pnvn-AĖ胗 |daD$ڐCX ϫ{3*}*}_bĥ2aX}NOJ_}2˦u 9wvGXR8 \m:L$j*˜gf'"I#aR);eu3N{ɯ /JvN&`<t" PS?lhB6Cw~|P:;K˹M+"o1w7o}~T5bO>zC̡Q;שI$b(bɖٞ&}v_kD\׫rn(Ѐ<O߮njGĨX; 6:\( )w0]~W15j>_ao/s?.1' "ȨETB)"ulZy#¯:}#i_Eu̴"TI̯aqN4 qu5X/WڕX`$pyX[>PM{E>˂UĀ&Nxh89B_'tAF}^Dg:7ۨuzNgk.t^ Mx,o>jS#u~~ss%""O%SMtg8"T٫i[L" y(4aC)<͜a/gVq:p.xi ?ٌϕoBGa+OzS'nѴ SF:~*T$?p>}ifwL.1T8ܡH22$+4 n$bW{~kڞEvM@fP ) Y/I_%6זa ʟ^|:Tڹ/^~HW13XzwI{ўzpf%Rb*xw.˖¹sN x# xǛ b&f#y'?i}Qfd!n(@zr@wx5{o!ӡ$Rl ]g]++aȕ7R7rƩr*v#}Rkn`r$;&*Sۨݽ^gcO.4~iR-aTFO wڑ-f5zC`FkT9L:Y7JRE3@YCC_L᝵Yi3yc?%wpo-An =cw}^YͶ#`LH$aŜXzPŀPFdYYPb'ϣu | ˉ@59M ~7ΎxJx qpDE:!mT=/YsQJ8Cpk'c+EN(h|'6#Oaxv$t;F K׃N ( uZcPמ6r/`Ў@ۘ ݬ<^ȄS}c9mǩ` E.!Q`_QRaac,g_XbzsjWQ=MB@( H_.R9g[sD6_뷸?`6Z rd<Б4xOyuL{j\}9p6' `#fWuߩ*lUGz^[.Mc6r$mo^ά6 hA%tTkJwNܵ?[mKpucJbw`OAJ5xU8EJ|/nł٤b)-utLFFSX)s[ѕ'qdwa_Xb(V4(b-pxO+'$Ci-b LvRhbg$B1n.Z*(T)ݢL=&]=>oP5j^C|QJq}&gpzjf>Zl# *7+"i V9ϐ}dDX ӫ+Mzv]"Ȓ2JRj亻>i_e"m%9ɽodY<1sg@lRrͧcRCF,C C21$c@Y 3کYPo`v]6³%5+iujʭjR4TQFɵ2xkSG~߿:OV`ک@86kRMB TN;*#oJ`?NWV0p ܚ`-f%!$pe.gK@584DǴkGHnڟBO\Iuxg&Ds-j{s r_rZ7O,A7'ԥ,t_@:Yw5if*1Z65#~:pS6JCjgĵ Qi+RSD&b ^eoźZ3{+DH,R}fAR%+bp!;XQ@]yECiDŽO{)աmGDiie[{=I$F?Gd78%);DwAؾL*9)R>KԃkL}ܧRrg]J'2pۭa|&Q sBgUCYf,*<|ݺ13n@/9w-q1Z4vJ4Qɶ BzǷHd  3eTlRi{S GQe)SIH.n8Tg0gv361P[q#"m{)n2$݋s1XED9I*WW{moUK"GȫWQ^B9E*RuՆh5OxToC7Յ 8#ı=S; }VF!BN,C/F!{&ٛA$Ȩ0:ʛ}J=H}ߑl%}]m;%PG_CNʅPGp :wzMƳw˼^~pl.ݕ./HLOm4OR+?ԗ|3v&6G&_NNz7B}I v}LՔv}tU]CV EaC1#ܾI8ԼM#vwh)5㭸4`C5Vw`bmLrN*oևZ%m+f{xv6]1sqDGnWp%߷r_Z9U 2i_ j7uUNa\vX(Wb^Jr/'IV3OkVH4OK}pEA2t^Y(b qr(k]Foq殒:xtE{MN/DC)ij7Ԭʣfn3-?m5IvW_̱j_.?o*$A !G0Tm(ugxᗱfO><+u Ц'K gdLU}39prj}'e2[}R=@B";PJvc@h1[mF+5sI.O@Ŏ8P_^~,#]&O,4z&Oo6kR0ɀ ?BJ(2a}4$.gT{zc%&L/*PbN x~}"ڧb`(/~[!l>yJ gW邏4ky 5 7k%2~=Z@1vLww4 5̇"$8@Ҋ)ADZe : z~sI[>uLŷBA"B@' Wi'nmB# 9; 䪹-`ǀx>&nz=n'K|?$Z)w^B*@Nks@vuXj|GXDZCs">؆T`*i]abQ ڹ`8 8Ƴas}Ggܲk/5JYwLgpt*=rRG"q0r3$qn0A,f'T2V\ F=o**?-HDj˵$#mDrkl|?Mu-3>NÏFr%;,}S_$+?+`a9іleB+kڛȍ"Zs~#nO㖓I}Ix@𹝵<=9#r,4xυ/ ߽W](GlnH lW(zbLf*&q(:@ ,J+`4N0ͅz_zwk%0L6[ %DJrtU דw C)kȟ3Kv? d%b 5o7F[ǴE1#!JQ) =u?#LX:}by"JX ?( {Sf@]PC?!ɶ.Oqp*w][~c8{%Sƶ86 ЖB:.'T (z'S97MM`b}=NdcWH;PXf[{wj^3gdb;ט{\ߦMژ_`pteNﭓ:?gLcmeac\|K[o,]Bu\O%겹@=dw0Sl3e{ϋ,@5iڵxxZ#``߈?slHB( -20e>y'J``*d4G=3D qp.7.$$C/og崳v|OGa bE?06n/0W8[q|da׾ 4{y,cS|}!xϋoLwl\~E|>%\_}J!rS D( ɾ]f4yJO};_f O=W=lj}ja>R*?ceZ?rR[wYqlDzYa72 J.XN#~0΅tMhJPyLLtuN¨LsMQ}?{\50algp*d1xwȶl=MW <%uY_}?i4N.迶 ϗM;Wl:r+v(B S@.v;!uP 9 `$ 'o'?_@i b.y(YT`m~# V 0hQI?f@@V22BqpԞָa^}f#.F6Z!hP~7uL}Pdl=@oO]uٰK1kXϕV,De8>P?hV ;j"N}L@.Fy9 t&dĕ̿)oa+ ,ݠ6J),((c 51OU6Xrd|7k=5F#C*cx0|So-S+Sْ˽05P?,v#{C.ߛf5k oj*lfaZsXt5ͤWbx[^;AM-!GokO-,df7K!.)0Bq(!#`MR}UC|oH6,yד+3to*MЈ-C1R^1tl/J599af[^XDMߛ]أ|Zlʏ]~?*97;^J>cKJ]Xg5rv}WSOhc"زtڣ#cNt66goMjpjB7? x}GbY\E>`Tf&3HN ]I֘܍aACBGj׶ 9 PG=:08N_sB]ƜhzArxuR+%dzR;WG}_?>a{7\/{kz|ׂ\2N]|t{wS{O ) EY2< J rKDc9aJF8DE$q՘Ľ{ֲɦjCg9,Jd$2P" "Wr+f=h}V Dc/{1>'kZwM,Y;pU"3A@EXPOhύGP*'/gEжʲ'^L~4S 'xd%#C ;Ղ) S/= j$9. E b 6۱+E@طGJp` DDIG-XCr`4",9)xߪe-'^2ES'= T],&'𶬠^UDbzCƾˈWUÈ&bj/DZrXȄH Qp nbi+Ae0(-4(p*MhԸp OˣL|ÀQ{{aƁm|wk"k*Hx:M)[eptGb_l(u_"/u3q5lxvv;E_-3Gȵ"[Cwmyaatosmn;-[o| I! s&~;iUiddsZJcsR3vwbJ;ϼgv ^VO5zA/^3PDxE4%.4ڑn ]"@[(#)o{/`zm _4b~ItZ _]kH`bi;J \D8my]VA> OvBzE@TKmG*A-=9K`|{?mN}l*@\b}8 O}?Ԉ7A"߭3"6#W5U-꥔*?"Hz1kuXpu$%~ѵʗÛn[%# ۼvzc1 MG&|= X@ $Zܻ|6ƒ"v9bGs-2% G}hz: r mzL 9HƤ I[ ] \.ҽf sNS>^.G ==?k>9qiU~t7c/0rNF*hE'@y?'ݽKghEø* Zdő2j)~G2'j(^|#P[x'6 b'@9)MN>I~c|'Am*{c" Jl9ߏR!7J( iuHEIPdOȫ+/~H.љ X%;"`Ƹ~ڈ^Kn/\9L%ux?s~k_dO'@HАBDB]>zSJ͕Y: A;̢U&Np`q4Q@hҀhA9 d65/ijaKᒶbij!OM4:<?;i韚e< $@kBHSuEHm%hr sXX4 ï? K8N*vv}+4|^M(2-!9DP=GtBX\)5(_a\<* 'go:M%Nw7 g/>'YkdY~CA`^Ap#ο}IlEd&_pʙ5)YP%HGumZae,\q![O9@}}N\:-=qD@BI|ϟO5s{u1?XЁM@K<i &9-4nϰ_')KJƭ'/[ԚVh$p=ՏWO|۪*0"L4PtM[SP} %NB%q;51QL}ӣ Ӑsʱ-" &֕{~?FOo3њo}U?ԋ ՅdXeK!O齎sX`PPXU4@w*!2 hI>u3_0;fu>[N_QlWL63[Z 鍥4V1ok6m@O Ie)Ȗ% |dcl`~ $ *he58*ZOMao~U{ =B-^nzSB31Nj.dW/yۄfe0yKI +1 C,|gNvfl`W{`$,/DLPAHDMϔ_'$l"D%b@EYDeoSF/9 0T;HW/>nXht[X0"FF3 {)ʢ>vi!,ȁi/툖jQ2j XL2y^چ $<Ys|J7%$UWVG2vHX_MXjBCz1x1Sw#c6EA|[ }'.S^8t庩PcW|6獇BTRW5i1MGΕ:Qb\e1+uȾr(WMX*p@\zV' ລtՄ3FX<_IL*?۾r>|TszbVeι^yE*F vl*O]G[I*d2ڭi膷J;oŘiapՕr(*xϖ?+Y0HNOIDMƤf IO+EBAWV!B@r+Ro+dZK~DEщ*p? +^SLsOz|)\2Q`eA }㢖jҠ2Wci]jqKO--mk7 lR 鯰iv۷O\vceFo}otz4N%| HGX*a=o»^};۳U] IzPSca* brNχs ϋ 8no?%+VZhoiWĵb3MRI)$ʡ$XȿU P/U)@Oc[=t|)?̤'7sN5fX*P .N[٧BǺWZ x_->SPԼ_ԘR,-@戞syK/#2k籃GąmRUA*oE%;3Vy\@ PNl:~mm?~MwŚ>qw#/VbE// S`Gµ]y_ )ͦ&E8edH" A Ai9vhb`Mx7Qt˞bKe- `[`oy@[cW>h Ry %?zͼKmO "m$UY˒bgGw q\a@.xa.}X$D# =]z0i x:4$}"xlNCI:5JzKI€JʜJ!E.%^?cğԾDLHZ3"ɶ7ՎY1LW Qi33iYYN.vmu: ]ہ{Fp95&8L~bG*_[J$OG}.tT*#. KNj&ȋ߾ف|gC ?g(MaGsAs>6aޗ k8JeAN-L{ ĀM֌ /'5zè&h߃pL92H92(̲ɁOQfiZ.X$=ƜVk4oAxBUI|{ Ppo$K\2Jʑ`Yu&W7?SLM,4tk$ ]:3$4G|#WU$C8%|)*̮}uRuY8FL%8pɤ?XGn wYgc3.gQ'RG& f 12A&|+c"pѫ|%MY`C 'zIv?*w[Bh;fذ2%!3*&tQg$JddHA^;vaؘ`bYF*XX*,Ʋ " 8،T$M (Ŋ%eX"4oJňDXKqӪ`9])z`,U/,~o𒼹ىu~pr6[rZ u! b`sA\pkq`auJPe]P 2SӐQH7"Ud2 eG:0O zvxq`b]_s>ѷX_c HImːxDžU( PRyŮ"4%$thJBOZ{ބU"x߅REu(<8R15dQiz)GlN-=* OKq0EP2y yBoKsCR=YIvr37xt{zΒlTi s )ub; p☴M3tG}$\\K0M{.1v[-(e j1&Touyai$Z*4;B1V7mݖTtScHLq緖8$KY梲nuN"A$/z՘9+Y|118t5ݦGb½d{@ '؄#ope4ZèE2eָGfa QAk?@>hq-f}o'UTzԉ>3&R+tO֒94)8H2Iw[d+2w5DR)_sEL5rr{IOd{ӄgur޲wHp22&݋~P@J}jq= b1uG}^Ͷ_Szi^_]Vq1B,CN"d#')1P86׼ׇ R[׭cgE?'m 6@B8Mz4I%rw(q K`6>ab_RBi:l+"ӌCU tdww:} ^b{ AĢL 0\$B4M ( l`46@`y&fQw?RO~V oD2ngrBYzϳ@gg[xosa7%n(}ӻ)qN5ð<7F;u˴KJHfYkBz{R|v2v=|'7۩?:~lq}z,afZ] ,ubb&>^}<RJ1^lmXԂk"SOEOZȄH@DmތF!Bnj8 ΑܸaV1`,B0+FXn;=BE$ 6ذ:JPܢO%ּs|/ nImaI,#?\^& DS'@ , ^-Ï9_E!`\zkp87e穒1]JdtoU߈~8>KG՜$'IoOI3POcWe?nX{\BL,Q #Rxǐ16]$ǯy—(flQ)1 )޻+w c2E/ e$Cw!E$,Rdc i"$G&[Լ+`O9eSdlRX[;nDu? pD?%]bCQ'ʢҎ@>]ےؤ}{5~J@*(E f~R}jJ=<`Gn n '2bF}߽MJRKy8^-0+6CivzVt{ٗkAmMΟqjզUh;΂1(p " o"nO./BHEZ0)|sZAEQWIӃU۝I c3J\Z "+D@ݻkZ'1o?~>OlE1>5#bOs:Vr`6gX8Yᶯp1F l@P`xD@D6\WJ(r"o^8.Cf|?QN>Y{3<=4qK5Dz\9" U{#(kq*a,2Y\.s`,O'T̷qw'XZq0׈,Y,". aC(pp ˳r{X13Ù] #EEh$x-6(ESH 9{^yOmIn㵿1Njq5OyIϾޯߋB¾I)`C9.'O"fsM!3 #CqB4#D$P!A)U 2  H)dQ` (X,1 @j*L 7!"&XaUH!I`,XPB,*$) |\<XYG0E H)HA!"Й C8sAh3\k`rPs}= YW M<*dT 3D>oV G`llMs\L{pU2Ao :dž3M@`8!Db bqMю1D.)<.Ŀ%[egWn醤 @W Ӭh8RP/)<~uiq{OF"6" -暇r<4%L^-'&x[b`WƖ1,7$g QˤA-}_W$Xlj!@* ^ۨz?o:jKZ*<\red^!%c^IH.ޥ !^ūhŠ|#Z)/\#h@"j,3$ͨ)#36b(DU #A4M ~RQ*pȢ,H,d1cX"4 O+dv j*K ñW$So|JA-h^,~F/cy$ ؆> .[i=BCSmO((Dz 1(7JkPe)2,rٿ\1oDbV+y#xw1,˾fwH<zr597) ȫwʙZ'VK>Yh0dӓun`$pF鯴>T3D(/Eg՞D(^;wjKd%<P N3AH4ep'/Il ^7aDUz܆:8[ R6mu%FB/_5:fw)`|іw1BL?l}@0*+ĉ :'o@Rv++G8SHr0hVlOՉ(jUed7VCCʂ)Am+>"xoɜ@?1KzwRO?/WPC Vth#L\]#E4603*B A|Os?u>ǿsy>ڝ=`zŏK}Z б_sC6w8pF6B]eپ)! WM2; 7w] FQKG59xE-q~f?U+!&\y"-NW?$as܎My4^o9Y9Y0BBe+cc M@I͔Ymp_E=‰ O췑f܏c·R0[si0߲M6 79w{v:S (+N30(7ʭKh@$_DWoxqؑ( TUFxWZcEbe'gXBti1q3 %,O1A[ E^(cM2ԐȤ{F3~1lX GNwNq8>]{: p\?:W8 , n"i?-Yv| Sjmwff(E&ÿoA [_gWūzkυ]_rY6?4f. -`^@;>ON<ॐb%mADakBSx_Kۆ>73_pU,WvJ}bɒ_n>o 86ʣr\P7W] X@ &_vvStʺ]6??P*yA̵* )ae1@^!Ǒ7ǎ\`1\5 Cbqf;]k@ U\o|C"s#9y菀KAe!h6M ܪJkQʖjH ק5g0a 0 ( /i)238F IƐ52qpI~ 'EsuIbnHA?Xί|uo6+=lk{UZlMx& 9tB Ѓ,_F"~;qccw&dBn):0pFocZLǎb6"W>V;%-NȈګ>&scSD1vaΣ!=u[֠7Ia ln d&-~!>x:/GTD/<?+EvQ@r>B@`Dj(jB~MM5DR*no#8}"WdC2[([Ey fwK&So dpiＹX($ |ܼFOaN߄<) ʍ +}dxxV^;ķ {qEG d@nDPb>wmdV+He.Rm^*i_&!-ZsAZu#IPW=۳%\ P's.F膒J |ڵjdq1ݺX;'݀sn|'<4y'sܠ}ʇq{ V@'ٜ^@N3 Sܗm ]16t[K[Xmyf-Jiy72K$KKOh j B/fC\->[;AjUv6h/j[$Q$1rV60[Zu2gbXQ{0$.|H~OG >|inluQ$=Ed R7ڿ\ȵ-2;:Bȇ1E;Ωq9'6 ` d@(ֱ\0yFUaUW h=!%~^SLMz(ĝ(fB-m?޶d߭dwIƗB0Ogw~>c[qw;dR!h"j{X0좖|<7YQ +Li{gz{ʟ]~^ZJ5xKE>)рMYЖ$2dBH$} :H+v%wY/zF!UP-JA_:A'P|M6]{?u`-R#U:B9&K3'Bv>;~&~cp-=tv~Raj ~6ߪD-?[/ZU`znBYDl3a (c v?. ;fny2ʘӥpgmxA X$*];'Ek<jS*E y N Ƒ 7$u !h,B=yRӴt:iw1f'sx6ImS̴!M4z~iUCl#ՕrΕ:d\Wd|ܩϦ?*ԃLd˾ƇX|n z=CjiUx),pU<  ex*'[JrNC c'6ӲeKk"?iNrH|.eRx?GQ2F,4T^C/ZGοؑԅQTa̮SU "AmǩQ7<eg?'^ى=EW.877WU2G \7чάy@DF drB=)}ρn@t(/N:oiH+(^cM@\8#p*x V h~]a oRl@˾DPȢ#;!r3hsino;_JN{3;Ftlh*m@Hzd4arb[.ڕlWA{f'1y"tcf8Ej?'b}mec S3tRv*w˵w=}{,N5lg q S) MYgV?Ug?x<}Մ扁`y/1jH,0ѧl yZ{<&X,2<,B- #,A% ՁFOeQq$@!iu]FQ@aY9-A.,1~jbM?MvF/eîkGXɟn6u@V}7ૉ4j'U:R=Y7&O4qx_9e߾(/-zJ1|iv:_qʵj00\bhQF&''Pʕ0D8P9-uz(~ "#hYh!8.%M$fO aR_Q( M)3c,L -N-7 &"t<1!"] F(kx9'0 *·r Oe^>)jsk`iDzI57n2aLjcH - GDq~bҷltm_nݚ[hZKfvlI)UC퓁92#],;[ܹ0g(t.4)psJth;s#k]RB&>Ҕt nvPVYoR2q%hW >\@KWբ&(uʑ5[s}a$ 5zv=ߌCt6:-~Iǂ .? k$9ˎ`k#m5 O.OH^r h׫Мze*YYUյ]9 UÛ[Nn'K }-s"г 𢶻0tQ9(Ya_Zz._|P uඛ{K ]fdJ HڅU1wvlCZ '[^YZocj ,)SebA)͝虈 9M D; F68\.<9v d?}Kؤ\^WTeoa6ڔNJ `WX!@)H:!3ټ LCc*)/!> H@|@ۍbg(yTߥ:AM@ ?ȎMNCgsWh/u%qB Hѐ6G&zA2 GA.pU'mIP Ǚ[Sif(r5re 1ISkLKS.mDDƛD+79-KR$LP $b B#w^bpg|qS}g:s.,",oK^&**km*""af$`,G%BP?Z4ɣXCI 2+>g\wwٰ g^SMLI;I$~oY3wjυί1Oxi.\{f0ݮ=.\2u]ig":H(""UVY0`<W[%&-˦Vna C :Q:|tp?]s$sË\%2=ȳf}UKsCW2i~S:ѷhSpo\s?JupT,&s0?oͮH-AtuPg}:@R܍NHNݹw̧ZI^:N S/A25(XW0 FaI]ƌ9Q V؈u=#v9yϚ#VCܕ&)::nG8n gceE>K3CTH2 aġ8 عi8?EW3fGHpMr w *\(aV͇xùsmޚ\mۡT8.nDst'T:z?ZƲجRTWM +a > McOwhWzmpgEIŘTàk>|Bq259<[/1Ä@_x:xAF+9֥7u'&We?y 4ǥir]:ܐS(QDJ侸* ,PF h)$b(+Z=_yKi _)i-6W5") ]US,鸳4 0z6\]{:@pib6ev\mgEVBP*wSaV _w7zSL\(s$G-K&̐I~$( e*p(U!iXuWW>ߌԤL,<ՌBk#p c HUqd)XL@vj̨ ~gZQn Uks_ݰQ|-+}K-_Ns+;QT )sƴ~%\.ѩYM.X+x=iKC'Я!6 DO EM1ZDŽHI,,s1kt4fscI5( G ib{F>`Ye c1Y׽=8D$L7}&Yn po@3,̡NF G}qśYδYuAtfd /$DQf9(iR%QnBLCK.1هΗ||>oS<ίy8 dZ>{T$i[UDX }2GOae?`gDɚϔ~T기X Ā 'uieqh fE&P /'{_]wz0]G"Hu$ugKO۴E6s;z7|( fd0JP)> dHQM$wr>-ѠVlFSȀβ=!8 yl&U0Y '߃IEckr$ƔQZ:ٝT}Ŕi #͠oԙ.8`V[ڢV5l`;\<1-"YW5ފQWxgԱ/s;Le- /|Ƹ7v2oYHAMEۄd:eD680/ .ܤ,ܠ1íbS aѨW; D8lG5Iٴ` H ךޞ89jqMyfW%2Sb:Zɽ4jI;P˼* w#*f<5lxsƌXKD9iDm(/⓰^C.'k~^Óߦ=ke,B f1\'KxC-xljXj3@A0L㽨R!aYC.pWNLH-6N}#.{k/lFxxFkA (JP^ihP$ 25Q亭JIK=#-WwR錿eSgp26CcpBA ̤1;tϟ CGa6[ʧ'|^#6IyI~wjge{:cTO`vݝxQB  LR( s@*R +? Rٶn{}J^6unA I v30JtZW d`"6DXPuRy Tł(S>61dB R</!EWS2hb *90V:[]^ %E]"L3 bLh!U!"NBu&kƫⴂ$Am'H2fK([Lӳ;EC@.s3Jd $p# "UVؓ!># C\""\{/?? r|P_E]u8;!q~l^nW}OS[wYgO} u.Ozl5&͝=hdlتSنDH@V?t'AW$_L̅C#-樮qQ~g\tNK2a:ZJ^䏗茗U֟yқ"M&b33w-:^ߟ5(>N!=v`FV=[9JA^AAq4~JT0v*}8y~/c> 7[q,F"-r;ow =o?<'\{ RD*%zʖ! 8v`¾7^kC k4B_b)Z]kJq\D93ݟ*AewpÓ@"]e$2 bB,$!G 5GpY WylX{ԁ{f2>mEN߰Z}*_Ty{Nl^?y7C BrO1O#Phf $i 4KvB$(M˼I g&Hp\!ȗ룎|}&Fp/?=r6}m!\Dˇ)aR"EBCW 0F$Z@!HL0f):s7REkf6S1 Jb#k%&)Ȫ<:4ɥVSG˗cr:рէR#Q8a}b U;A 6vT%#JT+<*\lPyD ,LB 3M6qeQ 5Z7"N9aezts]uLD- *Ϣ ?k9:DI؀` ?fЗ0 jB[:Ar\2/Yn*?mQ~ (Pka!gO!ğOA R/ԫ l4(5+ $BQ8E`@mM:;?:'"d|/FcS$@WlA'"A5o--VGNg9bpCgxMOp|C*zIϠѦy9r>OYW-:*K:B܍YW "==am.ϵ% Z -NW}觷CkT|30!'9ޓˆXq)gl'C^= k=݃Œnrs83톬2A2 r :]2pڛ5iH>^pũh2h܈8qμ;g>!JIo"JBKnْa&rVI&=lV^DuLTg!`5hQ  @v/^@E@ĥhff OYN4\+":,"jW} j͐E0lR:Z<2Mj#H%·ƪ#$GLj@1]Z>P1XZ6xI4vvD,i4q\?87{!.%U4qaqa45a1Te\D0auu1; iERufR6@D>j: *Tȑ;++0"fU9n/,]5BR [/|D! zM5`BEg!%k.b%A1J+Lr&)7 U4afΉ")$S$& Q1mKv)h&f(©!ɌT4HR[e d( /Z}|RR0,zΑ;,{0U6NMkh’{^xY9S)<(m(@ +Ύ(,icK@Z 9.(K, Â& a6{<U8ƖNbVeoa9Eؗ4=)|tZAP↬: K#-+J,&:6EeAXfG0fFA7q=r2}z6aƈaDd }-cfZE(#+%>^mlo8:ܡ oFy \0F_A4]1՗aIig=Pb/qL:؉ufRS<gtSX/V@IKq\=-oC=+cCP̭p)5 ;&rC$@o~+S _-Oŧʛ J2K&XVAbHX*¿ŠKEXȰYOi%"DN~G}jߡ:X)|x敹dKWKx?OY9o^(x?S-P/x]$KKHJbPM# c g5$N1;)!HPa:>oFowkbd\!&,\PQ GSMZ Z1fxYol{۞DAd +<@yt9_Ui9(`Zt/0i:WRK(n WuD sJ#M`DpĽ 4i<<泈 :Ê& 7&٬ֺTZQUU`h9V Bv%̊'2 D :If5+p5]j ='B,4 %%XIxd\Z=S[oDPv@)o^6Ӑ:R`Z!g1Fa /g 5d\¤v&q@ e) W]z崛˶_f,k.[JFE%}bg%%ռe$&E5HI bHvҢ5am`d#hKu3T'*!bPK;~.ժc*ph|Zm٧4-r<%\nqLȝ^Xtp |XRm9VbtDRحmiY)eg"^5-L֢ܪf aJj=ՅBGZ|P[XE]Eµ[RR&YL)e` %K)zT< RA,gevnJ*-M҈lVlDsj#SmFBR&`KKZ-Bȃ#)|O_JfH84#!11Ħj8%ytkQ@As X̚Ps zX ^9l~@}, zIp q§0l+Z Ou0~qsxV>SRRb^*(=0ǴJ`9>z"bJI#?}S'ƣ򑔗TMoWN*+} M GKb Sڣ0<ܗn=vNo>n7RD&#95!R[:qǛE cpʆ:Ncc:ΣsyX)Rt6\9{Msgd\I )*(Έl3qR5@Ed@/@ 1_ua Li{8vչ?n&ĮZ:Ԓ9 /:* 0o8׶l iGܴrH@C$B Qkek.U$?S}Ӥ/>w+pRtv݉;ȕ%$,y$pILL#b>YKgcJ))J<9'xp8(SM̥ @^nEQ Nj@ud͜BJĉj (I%Y&LE X0.!"ZXEt ĠD2e8d".gbe)cUD=iH& J!G)` rNj y22"ʭm@509JHZ(fJ aŘv@ly?P'.Κ@Tpخr)"V PfpLGPFjurZUДQ@" uP4ȽfP=h+o"LX{f)mEBzӸMoE|O흒FeOc-./w̲@D RTޯCh#dRY9 qkp@pLy+{]͙z%Q3yT7ƴK sHwp Bi2 $gܦz_"2JY=1zxh*i!@nv/n2,Hירm HtdJ6.۝7s@N" 6zf^Œ[ dp%GU&V¡]'oM劶ՍP9@\u^qI1\Op,.|u`1 J/p$`,m-PD^lY U zL"IQP0INBtLTRRC+̶.l&a+ֶsNA}Å B[cqU_ % pMhe.Y^*"b% !o^ MJe I68zT6el)b FqQ7'\lu p&XL^Vqp9!`Zm!aP4^'d@LLYeBb)Sr,0G g fh.K kSj.uW C!FK-iJـCbW.ʠaQ|oD^^${̡vΨL-95fB>('lF{!FL3LC@XHhZ!a(-nBБ`i0Y:홶@e2ұef֩Vtn o*=."uƉpr`Pf8.kyt"1[U{L9I@33p,n8bU+R3c8ęfWLbDj ԢTֈ%e:y1JmI!ԃ#T s`Y4s$`ɠdF)JP)D-hVIyX`ܚgFMj/ƶ{ ZHJ;2|7nS|ocDY?>}K%ʧĨN-jj>k5kSVaa;ЗfLFBfO'?Pwxx,i(CLV7a`՝W^l{: 5dQW,$xM.7f 4撗;;;?`'aO-H.9 Ɵu߁k""萘 I !fMܩBU(B15;a.[ 1RJHf0ԔH@j .ȲRg̟ }bokڝw?ZL6*V͊.5h{4m c#@E)ApX`S¡ YdWT%R$:7@&IM-RrJb8h `gsmKZ)!2ee!Rq aD U*˨yWKYuA9,- odg%LD#d IŎ^f.؁YjVKH"+Q,f+UP hTb HwANJKݻ.x}WH՗!Vo4H6?0mOt+ t Fp xAɁtX'rOɚ{o|I2by5qr]Q*Z TZf d5#%C:a|ձw34hb$ '6W͖VjeETVƂK6N;ZҐlf ±#,OPf$%uCY)1| ڋ'bFL끨p|*qWGRj˯4bVVkbb,L/T䉴I* = uh02, A[k!⪎ȥQeRY\ʨUu8fKK*ňbPD_۶o4E Զ`ukR t(Hkg>x=e=~fg^_ly;(Ʒ[eheG ҴSW>H+b:ϟ|,PZy+IكJK@Jɬ\AzQt6jUZiuGIuΡȺ) ?n{N0GH ߟQ,&/CyYTi7{Ms[Fx,9H> Dl%$ޙ{vt|8y_)(2]^"(W􉏾*ld*V/A#ȷD&eXDSt[ۃa*b@ g"}]"1ax5a4e m7a3iZa_17PLJBLd%aFnw[!?l Էhmd!~`S35-goOuO1Ȫ/ OÙ$0$9 C kU*K"-(Zm/:3P0TqC ru1w8+KԭJb oY+KBv?ʇGu!_]rNQ* ZF\3kI =.=W_1<=[NՄuLܞlsJRK%sJP54GK({d/5B٩Y6)QCLo;ADBRnxZ܌Q1d .`_h@aUWbRW LiF;j3:F-:n}L, 2T_,['`Z(*~]-8g_Gt5F'ܠȲvKFH55D*@9Ig)E=h.5ݸ`hga8xU.N7.VLܬsmo7e7E6mCJN{HVH 9q@4UL\'0*q:Zz/IN}=PSA %y%.pamtbosYjh-vލMC(׆2:֊v],M0z90<(:BJ{sjgM cT@``)c-:l@']K\:}ՃSaǜS}qtWeHm_c6֐/acm,csE Mn% k,GoD$y&}T3RC .3BMdhBSqޭ ۃvgTE?wE5c[+4kW{8&3 6s$+ .ziAwLE19Bu<80NX UtSb*WbR=L!h풰ywJ!DB3 Ab+"Tw5"fŗ6 H$Kͦ `eR ^'A6tqE4*jMPC $1FItk2ܵDkۛT~u~TW!iڿ3SV`T23ơ|=YU:?\;l\W W5 <3Iو)+_؟]a 0+O=ne~L3*Y*IP! 06X**0?%qߟJɪyvI]j=A"75$ԄJ?C#eCieIyl{?hJ&n3_n6b56C밄@WAzl_i)  _sQ8N>1H4#|!V6d:6Ǭ;G|t5asJcŬ2Ĩm7J,* ϔ̤^ jG>QK hDŽV1ADټM/ҹcc0$ +PRlu`>Uu9Ml;.k58_WR? |I/0<ź>n1U%c&i ujeW thYh_?V]f6[ %ePf5]}c\J]/a̍fx[K3+`7P:Պ@:1f*m5q &ZCEqJj$.5ADTٛr@?V`Ge]7yӴBBJ버*QXߦz+:Uɮh2dYQ%MѠ*ڮi T&9"""s UrʌRd5 ZDGd躋n;ϵ8<hah.۷mIs289ar4ZUhQ̞ꎥB)3 h7@F_X̧WtTK] ay6U0Cedz:/ /~L7Ha/Da$v+!xo qR:>2Ɏ1N?hr-e#4Aglsz +nF ?+ Eq{vto_Rz`6*B@Y$sִYteLھ HӐrY># $ژ|7uߙ:F{uM^ @Vaxz3e+'y}go0.f}<ʅ5PDR!1"멉>'MOcSIauM@)a>i߼":+C6(ڤGy,l ͵aW QbGʈ@a:/3%3;+#'3nddIiqOytX=@BZF.JW)"Fu %YwD) u|K[Lܕ劀N>蝘Yl$H%%٘+m/bE惁b'a3VEW(.9@qŠ*,8e\7޹k2&K Ca9[f'TSI[dbEtgp aK>iuJzXgG~?g`Ɛ̙=oֶXw$dQ c-}~ Liw""xԴ'pJh!Q;"?)u8|B߄Χ̽M44e8:#߆XsEP2bNAx?8%4}d#__*3Έ1.HB][Ќ䌠r(@T< 'L~#"(`a:ܟl*J!yOQe~#lS5D$D+L}1?-F5K 4-ز+ bfjHJY`@(hUd<ͧ(acVkHa-* pWnܖI5N#m;a鑭=~cR@AMFXb9[Z,AtF&x^=(& |US92g٭UQ60ǧܕ.E罪 3nؠ]< qAK vU45I`qmb ,[H UC~؍YWqcaIy4}fu{cg34+ja= h!hM brPɥD 0o6E?w^FOSDʹB+0#hIΤڂ-2t`ßP5p|ڡP }Ǒ$;O䨅 }xy=J!9\nGT}ԘrhHl]jf_՗@֞~]lP'U s}VPrf2LHVeDpFD-1ѭRb1v")Zޝp@v(%] |KRbo>mӫ?T'!Q-I (5 b eͬڄ<\|QHyG|rZG[( _85NaWE%cN BXP=wys*bD޼B ;a/u59acMZ=ַT>"6V\u ""krpykS35Lta\Kv(E:InF jwuR;F w%r{o|=1ug(@RXLOy|n Yl*M:t}禎BYqI>@v "3RR@,yxdmh3_uPV[Eq`r"3)OPMj*e=3EK멟 t6}~)y\|+8mόmdC9w#Df[tM&ķp<ӖhN:$GʻDC٭oP ؊B"!B"ڼZ635vMqMU~.8j§Q5DxYgGn] `a*ހgYaz8@K@LNr"%n+se/ekfZ #O tjXN%Dېd @t Lƶv-(\΂JTɡYWp``란O9+-82hAPQ CCJt-9S"`6z(z+$%@LZvKv"\ @v՜xGUSN\nY)porZ<\LCLKonus kqMe4cWL׶[  Uek. pe8q67өH۽kf+ۚ+ә]WXc.˗F[n1t06:5΄?WS~?ar%4`cӾi `w)yʓ0HhҶX%&2bR\41f`4BD:X+HF<,N=(HEPGLz^AJI*c-6<_zJٍ;kk1)FLba42*Dz3^i.vdk#9FhkrZ1b o*cMACU Ɏ#)4K*ڷTbO0Xie, I+6h )J xs4*&Lζ`v(mh.gDYXFUI؀D)-TA $rIE͒q̹.Հ1\l+A6Ƶd&Z-dXU$YeШJ.{LV):!mʋ硒:9 ҝӵ(fNSge0BXD3NZ[~_#- G Kf0Pe&zXp"Y@B2U0сȵK^U:%bMbAt YpLgRAUT8I4h@{UҘȶ'T: g[ Uts\Q8`JU-zX͞k,g.B1f YED8H [WU)f4pLoREe !Z,A# xZT+iE!oZF2j> UDc V2$m(]JC<,!/_W7F?hZs'q>vElM*2^S g+naz=͏í;El^/Vom]B))fI0hq"^e~"Q>_cuzg~m̴ӉF3uC۸'|Ŗ/I0dfKnMEP["`!ERr@-dz:d9ŷ.xob!RZ8}[ &$,C"N#{>KR =<R*b: pyw1C˅Y½ HmrCȣT7"~0"Ruֺ& 3yD渃<|h‹ ]Nq?eHI\Mj<$ IY Ul~}5>cڈM4o8#4r"-О\P"fTrbĶ\N:JR `1x[2CRh5lB`B֦ #^x! $S*q1dAsyUt#J(%zיs '0'n`Q a"dPQA?Ysh t&^R$d"RE$3xo>:js,U'2r\HqiQXEE-VET"*i7k 2Pn TS`Hb9B,G10s"5 z N"*!t_lq@&1NɎ1!6s\A>'ov\#~&_"'hdid1qip, b}=e[ )(Xkku(j7}-#vkSЕ-9=i^ JkeD-Vso }ss~u3p2c9n(Xl:Awc[vYPbZ.n?uw+k'FSkوR~jgX&S pYaQJK XS@}Pʝw#uYV7+?2qcg:4M[Mʙ/ED%o{"PzD(*!HFL!yɏ7Ị@[^.a48 9Ni!xDj5Nһ3fTjZnŪoUXܝ)tUݢ70S߳ޢ}/ $۷ģiLeb~ ݬHJE/2igӋ]=jz2RFW+3m|F+iGExUE~FA@К$u0i2l-BhH?AHxSX;?è/{Z:Ze sbĪ`?_K K, Lwszw(dj4a@@ Z eVn@96INHw%_2pͳHP_6~ό?jјPN^xsvU:c>0|]:(Qʙo?sVqic V-kq%`Z!:<,,B>FSr cR^ N{w)7k^.eE[lv֍a%zF9mҎӕiMJIM},NVp( -mtVM,e[RVaRjkUԼ:\d,>}R2 ߖϛy)]YjT0Kd+d +l=ݘI[^QH-`ӷXi@Oth=-b\zn6 C ,,sЋAT4 e!T -u鮜JN^̼6}V#`rIipI$D ^ÏW q8nV e'YHz-,ꐲB/iߔZ-ww obvرOg̺;@Lb_!4RFK, Q~lڲe/9'@:P-kNZƏ "GOuZ7#\0ZA\rF1PRu`ZT@2T~Gjr~_W\bjsxqÇ迂GMI4":_70j`&@`9]VF`<% p{.S{=wU (U&K=#|󛠘.+Ȅ8̫d\(: uJ7PDgmi; EŽіi xiXASJ[!+|)uڙL x cY -y{ъۤ p1s0LؾsB~otZT|.ǷMksyTPITPT:>ID˂?5dScm%aǞR]i +6|Tq@H'^F&+T2סicF +)o:SAlq|ky|nUXp }kZk*G, М<ʙ(| oe'+<5 `Ł1M]rbqY\G;DxA7HVq8 콧r2 [ b]oiDMMt^F+;27WMBJl+TL!%E*œx#EILW3xl$(2'+,D';oKaBBkYAj1{enM3?gfGEr$ZR\"HfIc'V,TT$C qECI%ړ]]V*[c-8s $=dz)M僬3SE5 O-UNڲ-1W;s 1g9z2Y-B4Qfz\h*[%3JRV2&)@てkJI cIm#t) 92J$gIp$-[&R\<.u&f!RrޣGDH_c_7$kU B^D' _qT^Yzh2_U >ڡLaljFe(/*u4ƽq蘥4K40/S,w݃H¦0%Y^aX[ !% CX2_T0a̹-;H,ڙ4Ԛ-[_Y-}PsV73Y+N3KT9LXS :W wr1-gDy}YPϩtQxE8;|TR&[Er{Y6%F:ti!+R_Fboǫc~lݣR\[Q@!iϣee3 BB &% 2ޣtBB c8Y4)l`:P#{G*.{>R*ӯ s]>hϜ̩AcqX.wqQiU> ,}/S&ˤ oFe>#}N0O6jh-1O^ԓR0E;9k쒏/-mCFm8 ^㛴O 6/#|B+y5vL]#Џ+=BU6Y{G:`'_0B ܦ.kWu"E¾L(/pvlٗ26ؠ4+o-]a*a' $$@CrWP~3jcܩ"j'H Z7'd4Z;0}0!]:AONY:%]&9c扡xuW%לA-sBIv !)'t7Ԙu-[spll1Ƙ{)AAu- ~j0FWU is#b!-t??b-ۑ8Q#;c2A~ğa^(<*6"_&fSvɴ(/8>9Ab >'9at%zQ |UD!(*r/Vd"!%~ia4'hi+UH&/ڙ f}7\Lcj&:LzLb⶝M'~1 Lzkzc=& -zCuD`rQTtXT!ڵ"9s,%%4(hBA܊kr'dtu9#WeCE#R2@% 谄hGeK`gl*_WOڔ \sA]?A=k<3(XFءx+V4A 뿽 z9YႽR~Kac,\^LJyz3wgtӋu@Kӽ[: W,i*{%zz~vSVv/sy,sF /k.\`1*4DK?dž Zk^@و``Uhe%.ȟ2$AH#7$_ʣܳz1EFݑu2Hݿ[o Bd rf{BX7k@{V_с%|J,52":xOJ_of{u~4o9g$*vb)27iLuSZXHC2/0['As<+G9'Ih`bD |&BH ~M#}qw]~.|⎘FȾn> $ S]1G =9CWɏ2M> ,~6-eVۏz.9tHF yWk{wa(/2O'fD;ifVKS*`>eY HX9)D0D%?K35OYH#~ȿQ]P]$[$DXzOD _P݋C1.Һ~ͣyis=4DmȰ"fjQPALQ5w _C? *XLQE%$sԷDVO~ "aF ?5Ew՚ZW/; (T@܀ULs~~iiBVf>UVFA`5WcPiD0bk}#΢xV`+c%8ŒZ*E,рB^0 >/]"7*RZZz9>0\4EVS9dag-81sVa!P9t VSgHՒX,v@'#JsGI췿yM ģ2{IKv} =lߍ2;/׻*jP2܊( 8e^~zlT:o8{:¤q9.֫!%JS8L0a$` r$VɘH7˜a٬ږ-)ICN/+3`#Z_ɻߔ~ds؁kx(JaF3icȧ$݆Ў]j#Ql|d*3%:-mgv5Ud9uڿELX&Ű[F鎜u3?mmؽ"t_+Y|g;C0aP*Ht% }WXysf=[ۼ -vmެ6;Dr}3q}ƥowbg㈟5Y- c=wU;9Y㵑ĺ< ZV804=^6ĩ pMdd$Ό)#*<:Lb uHH pĵK{HY[0)ꊡPG#1bCZFB |r4PSIcKJXiShAb cF6bGPDv-dkxBEiHNMe1C:vVHOJRQ.BaAid*qjwO[ $xDG I; ZJ2 4@ّL8(bZS+E$hz"hA)EJM-Bâ)Xz{AY(z^ @f@jA̤4PxڀUc1am2<)r'zKJk `f+ I.+ Pn*ؤ-` T ݅7Wң"57?ZEZÏOAj.+ċ|qƭ=ZqI5sF`h:5ZktcqT4a!ozq`#M4XBFCxJwFTx_z.+ZzjTH%q@p@aآQP1%LlFqVIOA&ʨ\yEpj**rR{P!"``'6lJti %H!o$SAKR`s[K,eM$-lB1Mi"f3Zİgж*kY,"y^HKxW0HJf9 "co*l36 {VDIEg\0=tP7$C+)QD@4=r!VZ$ *e3KrA Xy Bq^yX5Ǵ.ӳ';b/Fؔ%$ [qҽAH"z4ޔYQbv>P#ҏN㰵=LT8T@$DTRXII 5!g.oRTk;~q1ǥq+[P) Y ՟ A ggSiw3ߑXmD9M",zF0:Xc$.umX-x.R޿?qpdZ'/uʴ23(fT&SxeQo4a;U#XJ^Q-AVAdY,Y-δG 9`ݨJjŎEUf$n9ьW$r@EH(e,GuJ^peutQd-2-kH 30c)~OCEW@Ղ=%=Kw+؏,cFXF| \R&ELY | Hgn,|z_ia!(qU`\lleU]UTi 1#8B_޹=Ѐ>L.M9&X hN\,@5\ xⰜuޗiv/1)hhi"mmb@k뒛D@dWSAI!6W t=fFաGUJUt{_S =o' 7.F1uGtxRkJGԍ20zD숗ݗ+S` @DuѼ[?E[䌥PM}r^kSgZ^d;4״DyV{i`#^ 4r6 @'7(s-&iɢ^+i"C?S_|-lyYT4_]w;N'!lqae4ӕkW\ըBBCL$xm'6 Tɗr "=+g8t F _U~%ZD#Wˊâ XJV,#+j?&0(ׯ  A&LN/yckGl=~q@H4i/dTEX(ih)$h&}=W77U%VT⿇A?E,XRiD4]ٙUy B 6&VJTe^}%SnЅQٲKEGgVPb.s51oPT6U'u{PW_KJلX(,?o{ɵ6#SeBy$/\lE=Ns%[hS½CɷjbfL=ń'R6`۞g[K U0=9:؏@A FR&0ƪF/ŏ{y7걖;CB !D83 Z/Qv7n^C7#hSf1Egp|t+{W}Fg͕CށndQ|v[7:CC(: 5[:sP="m 9}&YtY%/;ߏyl9f2zGψ>ӓĽYz:x K;3\|8O9jd^Q'tȭ,<УK%!B <*kRqb% b0GY~I5=&P CZN2Įt @Wp2|{_>xܥEdd\0 ucd[FGU A%B~m w$"(X *JpDC/BYD,WM_wз~~DJE9[pLt]!|ռr5uKIMԬyk8`+Zs|+QJGZ<&#wCxeA9#g{v1!w?o?Gk!DN"`eUm <=,'Ԥ6D%"eԇRiYvaT㋌"Yȥ:5ԋV4\Lfthdm.y{Yhy?ܣKo+"NR (_GSLͳˉgZڛCt~׼͉40C/z{VБ9|lNDz:l;Tr&͑@|:N$D@v~G۟BZWj ނl%X}ST Qq0Z]a4BE\@-^ZEW-'1,ѿT €|xov_xv,Vb@ )-?`Ζ%_Ub[yo_ҜQS BfX|qӣ=)6=nnǶZ!J<^{̠,%<[#d i\g;vgWx1^w8R]v^h%'] Aj]> , 2B:34XO=3ov"x3inX]NAׇMVyEZrB(,4&? zM4lOQ@VDE3O)IP~+JYeC`kSq$V^OP]",)e!k՛nɦѽ^ll/p65uxthpm(.p HEu?o6q@/V3vA~b1@`e3E0G)ہN%G}fdآxi0 X$2˔;kU;FnWg~w~r;eKwM`?|C{e(zB\ޮP`ܝҷJqB\w=I<5R>`x$+OcaY[Ze߫/rF ndrDqu>MR^yge'@D}?3=ԁ tb'5$~߄$Hd)> IBq>ɴH 1_lIC pU! Ⱥ^$' 0jn8kvAg!ѓ3IG*X1I`7K9= /~{²C;ucp}MgqJ<;?+|,L>K(ޠ?W)ƐlYGw]WiY =gZWMt h'tv ±٢h4t J7 .34̯FA_Kkxl(9%[2|Ӛ*W$5I\#_}M'm+?o{qQҷIzjjJr)ܻ5s'5Vn6&t]Ya9vN $ܙ8l7gzt H/8}ۥn jhZCMN ]tM+Zx.-촐 d&G+5o}2muF0eawl%dF<"57o˅THƺ2ַVq?hpCOws{+$ ZUeu>6͢: Ib =Z1?J X}oLQry[S3xnЂj8>)%v䎭-Q.NK,Vt5'w1VX<@霿[F$N֜I9=9knE͗WĒ6="3iʁp>FpG Xq4IH(Ն?Ҷ@Zx+||}d>j N؆ )gKE1ƕM](O0SRkڜr*RHW&qw^UN# ɱYy#e4^1@Tzs㹱̐uDrӆqNCh@M**۷bܴ(z&:|91HTӚd,5=L5:t2HT)z Rn?Vi;;c٭wȆY\FihUm)n30#T( oi8o, vNmǙxK/l8tO`O@B%<7îhlTO2T&E/!XcIvTSuU]$=`YR%L5\q`.]CH{#RM"g(cs$I{iܯ B񛣸ٱFYrc[7z= X9Ȝ$<)3k-v +aʕJ|(b@Z@"ZAuZ^~=('NfbS֔]b`i4@J ހ*iɺזq0./0Fb%`kL {0xNN4VL ”4f*c# 48!840z!QYs['@N3gV[B &z$ !؅3T}2+ukMF UU *-(C`0z0s. lT Ij>Yn@tou{h̍YYp b zgȎeoX'EA%be74u` 6#GA& WJ}z<χg:[(#ݾ .=7Lζaw<;Fv's $X#UX z{:CUE Ȅ`q1fYD2bc jb0$BdQh7qTPQ`X,Y P\I2-I}|lZŦ:]%Uo|nh?s͙^Km˛م8e2S+s ǵS/9Xes1owZU(g!Y܄ k(X*'җO6 IHhJ~yo-4.d"L?I,PXCa}x!+Ŕvv[gWH)T]F?]Lc,*%Xb %)D8d; L4='9 "YPY7TVMPWZICP!|ZYXMb6.u7FZ}#X ܖb+@zFraeE+= w6n>֨\#:4(Eޟ6%<~$|Vx E T׸0WNT<7i*ʌDKҘ^0hq[wYr:s"ǵfNͺ=| N{lP'2 0U3 AO>f;(_ocrlժb/ __D(=D D '.J#B'o2>X!.yo! K'a$_rQ57>a7LVQxwa wnmN"PJJgq ~ao݂/" ⵩:SM9t[D\pmAF2^;%&Zi0~IE2kdb qnF}kS<>G֦K}IlϠ^AźxEo-Fb*W'AqnsB%*Ve7sjJ),&3;[{w`Yc LnZ!O~!P!Q.$  t',yfC:e18;!˜v3~6i /Wif+;L2ǁT~R`cRߓ V,EB"J0^c}]<ޚĎkJYr3G.pD޻e9ɿHA)ٮ`x9J;b^C&n;'`uɚC7~A{EֲkG_rLwW_Z '2 cQtto(!#@8.IK[kM)SX.z'w3[?\[$6GSHV"5H$;o;O&}Kxbݧ9 %d{jLZXie>QSŽ: ξӕ,|9=|G4p/kSDn(3-NtZ`7Ъ30 Ndad7g0xdDU0#FC30!`PeŢ<ۅ~Qf)˱oɱ,6B=/Kla/k_)JmDn'׍Ī>/zj@AyAq~>#*يo,s"(i8#.a"=<,sGޤ)9'C$-hɝ:E0 !#3Wav{/9@"ua227E~0w{wF[\]h@_ i6K,?M:J &'WqIѭWʯCla8ZHi$ӘT,,v'd*1xr_S\\py䶢l7LSXȳ fSx3~5=. [ V_("&G_-)g D5i` s&>_3r+5yDipFF!%aWH1F˴8 H@Mӝ^33־Ȃ|߰ɮo~x|, 0Qy(fRKHlYRbkq4'ء<" `"C Tf+MV6(/NƬL' Ҽ /_]o\푧*9zľΟ`=U^{G[ A?-E;g~Wo'E|{Z~b? N-W=k P>zG1ǎI^!ǒl˧azD x:?1?w-h9Is+o-">/. !GB:OBE u1ܢ(DbmTMR_pkR(=muJ>Pц˳H-Ac21)$GKk!UEc*,TE"EEUUEE}<2_u?D&JQ" FYWM5皹A hzTh"8#?HqJR b"4 H^mc KJinJ庇sŦ+"2F&_o|Gc)Q+a]]no js@lФy6N:>FE ?l ooK/B`~2u Zߖ+뤙G!͓xoqU>q@7g}^PLJ37^PSַM t;r> (\LO \ݭR2u9y,MIJ},NőQ"+~&DG1f?U/zy73AUy0Ɗ)+SuOm+qfT/j`&D㡴B,# &F*Ki(` 8Z!+cDlW[ ]VfJmQmCAqq4;C(M=z/f( q@&Zrݫ0axy͌=u܄+#c>y#&%!84f ;3b".v[h]ʠV[Xu?X4=&q;*7< >NPp,Dͪ[ TzxS.-WTFxJof:0m%{$yHYrG{m5(҃/״/)v iȴ#@sUrciU^Dǀ/1Fq7]hW1!ɯt uZhZ~DK/DH )1 EtUs/,Ϭtp M?qxXQ|3vgHleH ]TJ]{몒`0/vT{ TXx-jjG (=Wޯ?e E(hz,(O}ڊ,M>kM?4<.ۢ*/ xEO3C1rDsK=57٬ ®VƚxA )GUIIwRܹQo9Ϟ$lՎF-!x{JzeDT2Yk+OwxO?'Τ>bAjK:$ ӈe'|/w`=~zõ{#8«` "MtnB0`nQxؐc/f0G4`p:Uݵ jDХ+أI`BX^S ={mӳ1a^:fzrDd}PP2"C]kvBY5}^*xn%w[[[آW~5? fY|G~#2S.CR_kЫIyϡ!@Tl~ c^`r[U&(B_1i򀠀XLBb{KqVq;8I)˿޵g~:Hˑo??DR2ˬ3D r|U]''QL?mR:7%*u({uڥ5} K ؅$-wSD$<.#qfl6޳mqd:L*5)[k`G7{4$(S;,]%d`3-j)k>R.8c xH )*뇫-7_߆Tt$"tԜ . IBaw-cҩ&mc h x_?iA-"FH'-6مO :hBIͣ7\쓸Y" w 7˨O D`{T!MpO-_b'ytL/LR@_? Ph;]H *dsx`ƟB(g)r v>%ϟ.E j9f`Q!п q`) (:s ~qe giKV(T97-SFNXj+>972_#S۴{B}DekRP', 3^*`ah_XU:Oc:_yeYT9+Vf&OfԸaȱ9$ΠeH (HˑGkf-~v =Aɽ.PjX0j;d!s?K%a`c8 t tT9GvSm9Y׷3#ړZ5fRSF^$inOmlǏA.Q.6dPg*ى8( z yTd5 DUEQlA`/Cf!-eRgtPW [\Pl'eZg4$3M(j/C.AСYZqb|poؔ[rSCkWn,TQOٱVjA;\Ƴ)bNAd_Tiy9ѣE*VV$Ys|F?I` Ӆ2xx0:0h40_(t7L0a6.>\~c޽RFvh߮< ȡC# [? y 8'$ņǢe$`%@>EpeG-~5҄_v0=#*>jȯ;͉`S RT##vbL%;ЏŧХq48 mz LAEzڤ3f{ hqZDܠpp(ɥiPjVK\?7~*Dc3>#ܿn8\Y,}uUNBpB(4FZH۴Nڈ;EkNFTWL7־=uy9nI`# j!K{ZK۔"r b,XLrf*UkRu EN_4ZЎMBzpLEN[8Rt=wq0H&iIc\FAX@Q7qZ sUNjH\Dtě*Ңl.ְ93BPZP"s7!˜g!5.LnTN #מ;$x;LI,Iދ/!y" n0~vC6a7pPY{%q&5@oz+„LX :Z+u'<0y SwZ]rJ02@H i䄛:G7mjV}󇌲_sTT_ kitolq)F2 Xu4\Q%9>ʂrX["\L6YmbWP:'Vy`xv}`Vg6l^aݬV7DnZ{,W]68h Fs Pp<΂\Soc; ȣUz:]<*w +5lz,5[{\&0W3zC4&ojBNm  ]tȋAa^ 87)q"Hos(EMH``'"7Onaݿ{l'% ,s#%q &D.FLE|hN9 ҂#K1ȩu,jl~Z7ݣQ4ZQtvl̉M#&ehעVj;d^:ɘinT:Q`MI j&Hײ̟P hj pN'(FQ.7޳hQ4c9lS *ywYϣ p s5 2Hˆs 7/'"$Lq+ U=Yn*שVi? RTU,UXc`DcAEDTQQ )IEQA"ȤLnek];ˋ5Lְh<5}<)nE i\_{wǗӫSܰTu:.73-e<0T_^z7}zXa}Ƶ5'(dApG;">K=bXY(d 4g\{m*a)nPRv2smv]o4;h I)ST]G(AbnxQ^G=^&++*JSW%}հJZkqG6JO{1a@Nt63>S~V63 $JbJ4jT[+)#21aM0W.Wr'JsnH؏Ɯ.W97@3WP4j(okQ[ӛl綣UҲ8 IR/:T*$[^>ٱ6@?D4D"RzkTڴa<^]Rm*\4M97ek\.=fxBELoE.:I}v]PIb?G#RGo톒Uŗ׽7@5EXv_UȭTưrq"Q]t4R@-ڕsѡX1h|ի*a\~X<2]QR$$wR^ePܬ.`K>_L`pG+ZC[o+TuG`Kov R]nقj=WQ*4_c>(oJή;1ߑ:۞9q _.-*tޚЉAlCB:erZ{Jth#bJd#c sLȉ0~)R**r/Tqꙃ0_ -ˮˠvsN QEv}#hQ]sC$68q!Y SjTS!JD `е"F4 xBj͑Y@!,p\ʇAjb=mnFY셮T+8jx&; H65.N~xT.f}|$znt`@fzcz(<*us E3`{ BzKa]Ӑ4voXyi=6wMXi6?똙[`ńHi/A²j&2HY)>GEˇ cdu]T _ے"54߃6jGOY V?fEE u ,M+$̀3 _#JD3ŝ&VjOI%ڕ ^$ T(`BXckA+U!aAE}4&hDpK8c&!^ %=fޮ5|$B{H}pC4)WrsˇIOcбg7 *(`òʏ0hZ-*2_W l, uk= 4=@Cn#C~ɮRZ^B~?ǒ IW]% fxmkzqn܂.,y`4f<0hTۺf\s HV Ja ) 1S:95hkQdxlbM~>fMmkbJ lEVXbᐁ10-`lmqK5Ǚ`ƛsEe82{bl|v|4P۶5@Pwo$-qJ eaRf"X\42>,,߯ xgq͛,~^ioYdi abgA2^ ut D`3G]M6cXH8&T.p8YBC9D=. :x~WQbw9VY1\_5m&YG[vcm!_g# "g4Yood#!GuK1waș"99&WIx}aWeI&Ah<+lҬd!CvѿL=4p9Y{|qψ 챯.pB37cQeIQfFoٱ_X:G_=*a.Vwt&h@L+'1*TKY#[$FÃ?8{kMЧ&%ehTѷIe]xVޤ7uâMn}m# ^J)T$gO_,jң(b U`N6m!*|ސVL?!TO);D~c,$ x5ӖFnvF{ IB YC@ 0%L[Әx bokŝ7BE{LۍBhԯ>H>J'bMlSJ1~ 0hw0͎è =T5:, Gr{-XkA>_'@ 4) ; l4 l8}7{Ɍ;l p =5,*HY@8ū}ha|<A+_@9.<_yTe;p*G'y_dLCe& <1fAE i߸'haH vꋹQCkEC˥~SE[d(@?'DkDJA<]2ǪVg<t~e[)_u:H[ܑzzR~K1o&Smc|["?RH$Ln&*Y%yw]RFx\4wKvD؅oJ h0W`,S[ڜD3(hŠ M HX+re6dx|bT3Gm`JƲ3&E4c`@ҤaH6dܲLG,+E;j)8]6q'~z!! e?]}s_;zpZD3qb~S%T 0JiQb6 kaG̱y/~%})ĭ/cL[Z4!{@)j=W"?ǒAyۘL<Ѳϩ<z k!H#3)|c9eD~O+vO<"` 8Q"#v'!{@Q@ 6xL(j-ܺ'?mX2,ZjPMz;ș^B\kLN  #a0/~X*0yfvkJ&5 wog2{S0MAXpz.iS:{Jܛ?u jhXof'zQP!e/_S}ޖme)w,?P tXu{Jg(tUA?)>{~,0qӾ򑖱Kgp8*0 D H&Ɗpg=R&dPl|P|W+9kىas-l m=KILR|LS"xBGl{ӃYc a%.Oş3(nPZ m- |<3Gq!+p^wO#;8 uƒ Bp<<Y )nL<~;`.$O=8wGw$ =\rUC @DZa 7S9AۋAgL`Vx9C#3L `/wN5.moz)u iv>N> xo,B7_@DBG(SDZ(M#)Dk4'12A.rCev )7^ɼSa<@ 2K4 SUMB".XM%Fe/Υ1}3P2M`֛uh>̇4[@}j9rJ47Խ6[*ϑk1l ;'azYRA=Cwkqў7oW~#qIَaoj@H/q 7 9$O>ev]c:UE`sa-N)ʼnF:weWvHpdD̓.KhrPm"JcO?;F=MGjw-G>$_I"&v⤸ZV1oe*gۉM'9P^9O :YVj\AkA_fg/JMXP#қ2e4´,Ѡ+Qt$deqн&*mRݜx#7X͆;-H'Z:M8%fy[ 砲DR/+z _OFZP E& KI%Nd.XGWp@e9 wSMt>ASݚ|z%ݖdj11MF82]F+-U ׯA O8f&߈L挸)׿"슇+%3AI Y#t1 Q>':M/aGSevMt TOl 0h9RZ'on*gN-D;eRiVUv<^0'L߾C,4wd͸quv_v%nc/4O FX -Eg BBS&aQ;TgxH͛n-M:e92?}Kw/'~- JgyH&e AZ6$ޣ b{?;HLxM9oCr? c30e 93SFSC󾎜+Jϻ.nd1ZLe6,"C@0V ^yn~ndߒgL6?ku=/7YJL:P=韘/kd@,f-e%w]Ӿw\{냛|oO\1_JXӞ8zZW4~{0Y`MU3W ܈F9XB8ڗ󱶐)ZpҌL#=~gU<7Scz's~] (S3Cږ8,‭;!>յ PØwM%Fy<^cIjo+j ͐cq_nd=)SLj/0\ql i/e/rE`:R C5=3JDpRAe`9:\ 6=#48t0fzL #5{6~QyYiz]H_ګ1u`F]oǿ,:$ǒːh~Edž / 9ՙ*[1[92܌>I_>U|_k)1';ң63;@3'eik?E@@CYQ1ߪTU=n(Ɯ:W{ {uS /ȟ:.]ԤմܪzOU{vBwg#N$Qwx5UĦpP^!ݠ<5#=N>e2&,Ubk:ʆ|C*sx9DRݨ5Hq&HT Ra\T`tFӉcYҟ[tlZ] @% Aa忦]߮Sr,S2C8g$x4u@XDe. d_41|Sы@ NDL+mF$1>"*UM(dISjkBpٶ2!sD0~)yLCNroV=FFBIx X xD $/a4Of+$Xwn)25!3#}5Wt r9Ls\4ЃCy\Y%~Ow*5_@*l}?gSqZT[IO" Cp(gV=MxCARy FBp<'Һj|{^h° ^]H SpFod$Rߐ{oKܫ$2Z$ 3nօ 'p82 RߠKQѯ}GwRۑ6EHDkyj Tt.:h&Qt@D4%U mcȌ*o4`ժe0>w#^ܚ=no:^?{rx7.!i~n|ܳ`@Qin(o-Cb.~kq c"A3L!jx\ ,5Z9jݛ?jlO?ï?^ MhRXrDrI i bP9/Q_1 =NQGSPΉ-ۯX`CAj{ qΘE$AޟXihi(KucI; 2825Ɵ$b)Nt9P 8.\^#SH˛}[\Ǣ-1Ɍ qr%Ir!N08@!3XN#\0C!ޯ NY˷A`&_Lb, ՚5_塛%j&ԧQ^|!?w'taɉgn / pϛG>a%Y"">Fo[keFy[c~HalB)r/Ҥ7dWޟyL==s][_uOBzwzO{G2 R4h˨AfQo=LEdc ]:d}[գTb(Ekb *△7vCp?-wn'ďE̬My I%]{˙|5q>᠟t+ͱ/p[S8w)gx@X -*' H*P=R0ŠѧpPfD}K̴gPRl+ףs~y(A_>#27XRaEw"!/ƎT<`=dcCL(Ca)>o>f Nr#u裵_Di@n@n⸳H`E8V4 *qJt'4oŁ^% y?|w1v:oGhE*9G:4A%uZU8Cq1# '1D$9ȾIr {ޥ   `$:1b1U}A&̞,/xܟF̳gvfy9q;\+B1`ısX\ԤAEa,BH e-ZE"hPߵK!ܿic#Kg2\w.Ώhl /z;F-Ͽ8:2dP2ߛ$l݋d@wdZ.4%1#@ۦ̣-y'2,H䎦.&ҿ۶\6;V2DaAM HD PY#!! ؛lCB>  hΨQ SxMIʵf\a`KQB#)y͐sGRw-ڹ=J C c-z0xb>d2ngR>'C@uW`m=\ -;NZjپ@ pAUB(C2ɻR[МLX!_TG͕t#4?DfT1' gnP(GKP 8PWp&v.kFդŝApi ߟ>˴vfXJLwqvj{ Vį0y\[20QHVmL{[gF`A0 >6GFe@vw!Pky^9B-#˲%gEy/k̻mkxDyWm\4Xo[R#Ǘi3UCwшg{1B2qحI6Y4dә!c%Vd2 Vos00 W'%ݓ"kjR14@)&(&† گ^7PN$~Ͳdvo+ 6# ŝ[ÜE^ + 7Rdj9Q}CT+}(jmk>>S_NDžS]yD %)7BsnlC-mH@`y!zN3dF'w?) %Qj$/gZ"̕ ÖFc*Ki:eBBÒ=d:=7컈ȥ?xn-"PutoM@-bF߈~89ƀ(ځ@0"nFԦ9YI T AlT&1_1HmAPA02d FȨN D tEVauw㚐Vߎ' bߒ{G(IB6hMvK׈}3Fc7sȐ D:Ճ޾sRw.`|&9δ/$2 ~8K虉b*Eb~[u-ïM6֢dIة#vU+>C0*8A2P1Pa !eQ5\1}T2DZkIymI1z6w?nXH?>d}9I}s-e}Ր'Ulڋ[gb,ҺLһJݕU/I@-zIrȑ fw]Je`ʕşvH($[8F/ޖ+y^[hH]f13iɨ*(.y#oNpA{}Crt6VQ)\4Г`yVV[r<ݳ iQ`~@ˤlBNz{cmf"ve*HJ'#OyF?>dK߽”>Om&~)ee|qKP5>rN`]*>U}v|X< Sq$Oh跻q JH#~VgX(mÜc(U臏 N*pLE 'hi'&hd; !X@CR1tEbtVq%wNfЉ[a,wp[+މg?;O# ~ D7NPRaB-}ϙD +,j:5BDw׀%6,lF3g5Vc $ $OT~u gXE+EVVTQ66wE.1.4o>ԶZ~/F7eJ}& )GYO.,,S՛&J* hRU(9t:Ņ&>lW45-kUf߰{/$ z 2?^du= pYQ:;P}gdW-d{/qA)eUR[ {( |B_|E|S{7 Q4촦(*^7̩K %c,u4n W>/Iu>BQDJu"|W9[h I-%^e^^QqJG^.9ywB9>YQGɩ!H΄ԫI`c^~taLr50JɜN 9O;˳rQfE|QƓbK^a =1RJ#`}$d0^!DDEffh)gȊ"KYKh4i݌ljY 4JXh]P I04`М' %CYzkT LL98+E˕r*j,ȰoUIdY H )$R $, !ZrM=f56.Ʌ 7JĎ5 "4зF$HrUH5k֦?5ZrrPV#EkT A(]"^C@AJ+ 27TBIwk53BUDc0e[D]DykpL1)o&XgE?{vY |$j Rp,I"] e_Oo?9ܵ̓{҆WqOU~3OV94G1Dr:m73>\B (bA|+3/ EBFiˉB" 1}4qz/YKp0c̕ft!{ ($FFԊѡY RE"z h@"EaOXPTk~zz j۶1*‣H^= iVMw!~7X/6 A$]o#6ia/*zk5'7u eckF3iZeoWn~?!& F8#Xm_k;5`W.{@Hjt Aĥ 3ݻG5dm}4zsZ:F7* }.%v?&F J2JRA9u38 y6#~Hrk[̲ق02ziFDeʋ1}"tVu~EyMV,fn}>5GQ-u]d9zi@pQM,_sZkܘ&;Kh Rs!E$g%b1f@8 [B^Y%Upc0ں RN-wv1l *hhڪ+~v,JRߵ9䅕(*F8 ݚrׇqtY?v#}#p#R࿑WLa},Q00v3^u~DN2fQ~vURJ_7I͠.x&e_޳sjHmaCҮ|R|C EJ0JfhJ#E,&pq/bE>Y>lWv1C8 d@ǐ7e7k"C((ryVEm83F^4 nZiTInXϣww{EOŦ9j4 ,뉿`tM(MqaQN䄮fsT{ 5]):ՂkߔCo;|9^ZǨɳF+eIH)}FytL[Bx&&\jGYZ ݇C8ic33@RD{ ft՟l_RaaUO"Yh2ч+؇)χꤽ8a BLkJ̔jﺛeje(}pf[l[jv%e `51yKQ{۴Ȥ'}p/7?Keb==F y*nk9*32SbV^R_M- ߧGcYyNڔyܼ~ |c -XHh*[gb7L."{UqCpNCHq6q@[!a>[ rL3)Ec]ѯBF,y̒ `k2B8W;\!JnE)m`wGM)jPcLٔ9'ǣEM5_=z첈˸?`5LNhp9<'G",&hwƔOM7h1GZa5)=O<6&x9^Ih|Gc'fb0Q*c$J$:Д;&B,%+$QlL P40m#Pn_y~*7Et'(X^<^mLg@dYvEv*(`"m!ED? wzN\߭pvoY^FPO^V VGS/Zn؃7k%`}fpBǔ+X/)` vivY&{lcoȀ~?z 1r8{4*p-^H[tejWlIMa.Zsg5ּ<⼭shע*2LSJ@4,MC;ۣ!)dZ'L?ȵ|LI9"acLvi"d]ː!o'%+A!3MձH|eQȒRU?u0yj Y"kN+ϛd" BM1.x#ᤧ0gox3@d{~Tԗ<QR&{0wK%veH *VnewE+X *XŠy){7MJ- ߮N9%tQ3.uq9LM{CpzU$< {>!$%0?ؤ#OЀyQ p;ң` CAM @ҫ8/ P*Q ި؜6I4@HPB>59c@y`x2}\ 84kENy̗2vTqpG@4a#C]ӢyNvM̋U@ 5B=VĈ4wHZ<d1d/>Ē'&#ݖYe/]YTղN_L]C#f!ظeq#x.#I[>x b+_qۇM6]dN Ñ%$q!YYHuB=6EѪ\  :aJMcab'qH'_S !;ЪNa]ߧTaF r@Z{cּ TE9EDV.;-fePJbx‚&cb(0Cmg&7z4  ;g.Vǝ?#\d(cF V r*F/{1rW]3&QnFDz?<զ^K\~Crhh?m%, OST-r01da^wL;]?mŽs٫/ozlOK?7A,mT، 5RئXֿ[I$m{@?|d{b*nBzbb!5euJBym]j{{ys%fwR\%7cOtL%uv]OKNdj/B5>U2 Ծ_~_`F]ҋڟ[ PTŧ&:[]?߽y)*>pIJql> 򘏦 iuYY[5d,+NM6B5A~a:i`HN_R򟣏-?2D:,JRgD # "_, DTKv]m, H+ʄ5&qkVA(}i4OX(bt'=uǛN 0?&!޶DWJjЀ\e91Irhg {w̵ڝ@ A5QYH?: |kK=Yb^E$haԽ#qRvv:q DeH'}Im)a 9ְ ж{0-+-#6)@( qȚ+BrQvg*}=H2MQkV]pU"`@ 6H)".ywdZ= [;qDl1o}h_g  .ENQ1X{'7|''CYSz9COeMLZ)6tq'|OHzTV v$ FR]¦?O3sd c5l5$!dísY_sMD6Y6$GR# yt s(IcFMatt eg @Ê"LIfR.4}dFI1 !]}&zYR,շ*qI̪M-y%[ N'hģj_o d5LTZc`tYV nZ[kиӳ õR@FsNu[ n$2 f]Pc#;uhiZa'E:sH-rLѐOJwF 74=m5\Zh %1]gu[ wd\ڻ!L>]jf@ (eeyP֍4b0AF"ID&rn֨oI40T^îUK} *&ό)i!ҟ[JP*X5dPߥك Qa &;͟f4i**4`-W+7J+=mτOnOAg7!z>}"]]P( "u'}2`O ޏ[C|#V jQx-G;Sv`= 㳝5:?:31z:Z^*?p]@P07U'ijHd D\%K{LțZa8@C/k5{@=c( J,p/xFi<&]EZB;;a4FnB>[ȍkcӰ90_Ό´T FlM8@v\x*bT泲OWД&=]YiNY0,!~UJ2Z~ yⲍΥ3sZ#јV{q &P3ܿ6('Kki鰞ALu3﬩$ʸPQ&N`)™ݳZ׬5zYqaːݡفL'B}쯎C@mZha(v>:Po]c,}t'+$O;b~ d]ϓ;}/jb.M¸wyIhGs`Wa j ~64jŖ 5_Jd ϶ՑKbgގZ-cߌ6BWAH—l{OFu2_2qyPd>Ӌܙ)D;TK*6(Z5Ϛ[ՐV5Qk)EU2FC:|dΟ=4  c,HO8u 2S&MHOHՓ|Ys${읯Z;SSdhd;Jc:m[HɹZ9aLZb]e_V{  άr(xYI;mF]w49GϘX$cT/{mzneE1Y}S'd HLze,b/Ry,r =^A`% ks 5Dt}CbxR(rZXH+~_Űb),>ʱULW֒[AmSi+gd!@-kHJ0],#,$p_g,e  x5`<݊?f+K\=MC灡pLMX`/Zkvn5y{XPR _i)TݿM4;))a}Š[x12s|BuIV" 1Ms,B`_n~p~X%:䓲E/q?9`(`KhH0F/=,lTVi>`N2G z']kGXjC`!9o=xb vL`W)h](XhdEQoa *݃BU%P> %ç :7澘o5Zu2>0Š֕C%c84wZ)fu4kͮ3yO)"qOב6qzgW*[pGQ$ OԎ gBd?=:m2 %;֢'J,QH1DR "Y"2tjlvR%&[#li5W>͜1/=THBhN()Vˆd]ESˎ0zHEGdzkOn#7CUc`<9 (ھ\2ޤg`,""½#w,Ia+-͡p L$'72 0ц<ջkΎ/Js(LsfJ"^J{P?Wqq>x!E5i{I0SbCW믩L r72yqo4K%sOmjVeR-_6c njdDaZ1ctz&:փ>6ya^zpxW.y'tVβwj"CrA1!S&%mbFSP Iep,gH/&IM(U}d]^\u7dʒm{qM[KʣsǀԅD']Dz';B}$NGj;@pLOJEH{D>֟yu}GO[hL~UNd\ԓ,$#g7@$@- Yn=ݻ1Hc6Ч1ic ƾ%b޷yO*iQnJ#0}~NW~s-y-؏fxbf6"לz2BXUAp-t(N"g @YSp5*Imi0[+6Geq1B(ڳ_hh;Ѝ,.=_ɶJǩ֧5k߀:/ կӢd#"(`TGݬ#׉:^Y[+siߔoEFKPDhQPE J j{e &@+PPXd $P-"8 M&*Qrnp#[q%1d1ȌA|hZ "(iagРÒjrLiZ}_DU痓6vc #Qeu1 mwϺ^^NV@@PmRoc<=~%CwF^i+iɬzܳF)Ͳujq,ђ yGa=.{bϼl_B 6?D#TuF 77sF;B9Li jKK?6(@[Uz] Xosv rks>B/g](~f[FH ;XIU;z3IGnmG5P+hGe?,cXBS̨,=X cV"kUAųL_ݷ;-.omDQVPX Lӝa}e=B UKDiVRxWC`(fP4y߬R,#$?VAggBxJ '>Ј2lfV} ;;`NfsvhP}cN OI/d `~]bp W?P䐔BEL{b-cL?G){jN,X&#VGUk37^eg,+ 倴 _ؔ;5 Fb|-yHW[/!=~$y\74( 7) XBiŚ̠8ޯvzLF5 !Qׯ+}-[<i/dլh.]&[bA1F})dy>ydPX89Ru8~D$7)Rrr6b_q!BCK.^gHMډ1 HLϭ~epL*u!|3XCo-AŅ$>cOQZLgXK~T$#WL2{kׁ<I6B Mܼ%6^Z7$j >%'˧5PPX+\R <Drm.+):1ЫhV%,#xF\JT Y?/&HF=۶$uq +(!h[ԯ>j=z>ŭH$ue:/S̷ϥ[voy%x| 7j%Mow-;w5 M~Q}z& ?)!)×ss=]n_W ^UbzhMo6dwK_aO.^vBP r<]muQ|N|^A,6ghfciͣ둖z#޾ƛ1OC`2M#!Q|ٟf]gO~{mжU .9D N˜F7č~yue=E JB~ x\͝ȃX>fqۭуXY8ԗ2gu"E D0Ha(fR:xCiuSD)O)P$Y^{|t):mFWziݤ7' ҎDB]+Lg9:jH+fQj $A$#YaL=fpy Dz4INwtvFY%Yt)d2+ "n [M}u мe%N*djR+$Œ1On]SqMF#K׭Ӥ9۩ J֬XRs7ڣpg ҐS%ihMȐL xgh=ogONdnT`X**Ub"bASJ3"*1)γ8ޅ6꿁}UяD.L^k@mc+V֘ev a p~ZxmA-[0W garHh ȓeVN} !;s,{[Qon^ :ŏ $40^2 @&Ě$&D @ޒC|#qokbz<&*իgJk^_CA'8aSVӠx!+fd)_3w/MeJUY WCgQ1_tDYΉƒ,;/bf94~&C]?nz/>Vl)o]Ayhi0 Gȣ 6f?:u=GrXj6IN,l> kz(6PZ:~Er^DOQƜNXbH~T,khH-=S-*/X)w&`grka$`*En!2WݝPvOS+,˵BLz4$1$&@֜rW{j{l >#L#6d+=܎EIR5~~I.g4h/KN߼QKR(4{to YaWv 4JXXT|Vk䃨#$( `y=|G,;}3uwI7Te Ч,c^ߓ^``AQAtŖP2qb:+U(#FAH`ej/T9?]RK|_dͳ!@hqY"i,f,9 Ufؠ~#41yᐐC@[j*3I膝SY904t?Դ켺퟊L;?0٢(/_@v#$x)~収5M'9F~ؾbiv-(X<b`p"y ,PLHvd8Y/"[H K sUyp:Ee^x0#3RQLDN "st>RWq lӸl,!~U''6ĎQOʄᣪ~S3 sas. "n7󊒦̏gR](FZa 1h4t}GB!s4@ix;*bO[d~ b>Eqz7Eisfnr e#&:}6'5N(d  1Kq:tCn4,`}̹$5J.[]}u/3lplďU#Uv]C\f3;@}}.+뗄Tx>g/# P"c3^k[$8B/ ͚^=G.cuHAs.L br|[7e!!a"%/P-Lj" gq6;؈41cȉB-!aP7»m? ;yӤhfઐq Y$Q@$1&$ HLj | Ȉ+Ub*n8&x'o/&B*!/~z_띗iI':~ NGua6#+D[rٵPTk() D-9,B淋uiU\-eU`K̮c)ߣ?j_:4NM?4e,qNzfbn">Oo /t H9,^RvJ]K <4aٌR 7bE"pJ08`AYݼMi֥Lvv󉀉ji?]E*_NR{DLzkD?cNz(VGVM7^NV3g};[Uf8コRq^<"WСvP@`49/ϝ̢OĎsꏑUMlН*ݕ" H#C ;l/c&>qLB(u2ƒ㽩T, |B85h4Ȉa`>[Lc2#.yak9yY d٨g KMrBq%'amח:6\':*ljm7IR`GB+{W!`,].p޽"kW2%FG؟9&dȥ 5.XWFu@Թ" sR!!M  \F 9\ܒtr٤ko/ϗ?r(ɭcܡO%_:WHr L?vu$^b 0w7?܊ S/ۥʡj"Pþ"3ͦMUI[Fy3ҒCq[j #tzx̗3-n[[T)f>gϸ Xpnܬ[^QS:3sC@F 1qXPr#Mg]P}l1E SikxB@b! :fJq\N_]GL?.k3%ЬO%="#wYx&vĸ|*w۬JGcZ{'i=kB6aovM$%>l:@D!H9Uǚc q *.`_~F~LK"]}#|KNs{s})K>Z##>xJ|RCx ŧ;י7j4/CyzA1e9htPy>K' c*[Rp^]egMX [ !a#{E>& 8bHd Q*a "s1xky|HiHurK)\-/"4$HX-0Z,<` B 12Mș!ԑhk*]KLWx[Tnf 6)fIe/xs5vS=yMy2T.BE-^Z'cNVJ_#?ݟ W2*i8%B,ꈉ\taѲ5Hv3jfShq`.WَgS{V4'?pb>Y1aO{o;N8,`o D_|b3OmBiULő)ŭz 2@FP糈mN)ܔ@7NϷ6H:"vQ A~k ʭ(0IjO7줉JH 0ԋAs92z  c{#SYb[AbA"HؓC_?C7Cȼn{2.v:o݇48T˯r^HΤ)@RqĬӄD'CXe8+a%UUn!5crsLZ^akΫ7bD{ylkNhBo}ð;NG>ތ)sv3*)Zx+yq~*超{ޖM+ ᄲDr]lhahd2,ʿ}XlM:lxH"M5<ثq%Irf/ Jhjxdw2*aFAXEա ڪ"Pڀx83Qwi=j+M7F}ԴQ>¥jHϓErs7egػ9B )4hXuh0s*jxO# FUF#Bqh$ ]c "#R0:bmT<7n4>oK),DV3؞/ۆ`/HP%;gϥ=h97 K- vtP;L?|~}df黯s<r'mMYlr3Uh [fvN Tn3c7D()L$̢Kdcv8v 6J<ͱNlA]#rf'fa>Py5W1E$d =NɁw aʣ!P1gO]+Z'~ϫ )W皦0Pit͓357:k"8.Q{0moP LE'猠Z}0</ ],Ni'6ⴛd<4<-2S!g`V&NxMWr{8{Sdl7}:RBL^Y&kPo2e4@@Bʴ"GF6 .Dͮ2ZzD˿jQBe9ч3;!-7 ېUrbu92!ly(|gxkNnUt+M.hPh;hp/gUs(dB+/g ~`͏$Rs`b.BejCEEƹ 9h$ܳK*0[\f)J h4w5R[Lm8]˝'e`*TU6 ؐϼ8=W&O?z>"[z .|2i.B#ICbpo6p!]PV``.Zqp(4Plf0-]"\†YBYﳬq@A64_Nn{%nW:qJx2s`<'NLuW.-SF>_*"2fOFf'.K;'7}s8GR! H1La AED@]BH5Ýv=|8,~7Kd|䧿Uѧ54&8rEYwYr'[eZUQ *EU&KOOy8 9'H*>_?wwD2ꩦẃN\?{n.\8˺U/!GD ͨb:_ LrC1U("7#HtJ ET+SzEK'`!YMM3;̞8̉ KlYs;&D1ژ9\4ev.Yɰ_o3}t6:voXmoc J>95'hW|")__7ϲМ{poz1O# D0F(ܛзS%m Cggqe(Z4!M\_I~=\#'3~⛓VxVRy^ =ȠjV/gYݖ&tW-,^89V?kIj"k^Vh݌; o*rTŲ \8 (_o夹j߭i(̾F,Z1Rɹn4F} : -az_Js/ o{T 9ݪ~]Jw#,'*g3ۉ?#VĨX}b7; ^]U 2Wꭰ}G;j/:?$Z*{iP|Cv%vz|- H єA(-]M7zKFSsN2J)Gi<ڗh*䲡9/dd4 I+Q<,:==K~BܿBmr$/A?BH''3?`$ z0.}LU𠶯Ywݲn_iFeh/FY_:6uS/~[45s\fأiH G ը֤Q"fM4' ƭ2DBv4FZca?8b0B4fy.^*mLjpci /4/SF?xlĵ8M _z:pZOy( (AX~#BO53GRi 'Z }K l7icO"aY܌ԆT@KQT7{I{D{4W"βgxOrC ?kLf̒ZkWz8CTsmE^QOk@TPDt R?i YuߘSjkٟӣ7طO~] ts7*A&h~k|.tl\ qLbﻞm`( F7DR_|u/+_:6mE̚ՄkG^9isU,_+侮oy Y_rW@TG{j<9PkoQӛB4& 5: aG16˰` I;2(ToD "(?Nx}nJnMܦ/ZIZjܩg] @x.N2[\;q7#EǾ(9XAehŷ8>4m ٟ˟n=ϽK͜^D\Zx/{ZS+5ZR?}s/LFLgjksVkelOmG+oiPEB*^T'G+4d J۠X\y^o^W_C{=QWM}c{K Hc#+C[S$"H45Oӭi ?ftGSk((FrA*ň Ij gL!a640~nk X‚?tk~P~=Q b ΛQFwbQ/>>B.i}.XUmӀnųxuNW9d =_%zOfofҽJ8G¸4uҕƙGa4t8BBj2ρ!qA1i{l)jt|o8_ySRǦ{N$ 6Ux]7k-߁WP?K.0Fo?}^kU0x޼G:3ݘ.tnC.ЄQ̝C5|f :ǖwI#.Elo(0 vBUꃴAWY'1>^yb8|_<K7YboD_R6Mˆ7lǠCiY~v4$.}iQ}in1F6v(lʟ ,dS#c/_搊#Tͼet+'_d| Y]SkUaFL?1{N8ޕThX-4%61DK}ɢE_8_G /#5R6- I3#uZ}ԡ8W&7dEpH?zѹ$Va>7\#٢y3CxOE_b*.ԓ]?J?dؽo-$pm9G{CпNw.=SuKщG {}6U 7zcq_s2 #|w9ë>iovW@VՖ77,mWV'}0]uXW/sakL `o#7yߊ?wbF>_HC޶z?]21hhH!!DڌőC`P\h3FꓠUgLqG^aNEY{pF蹜-*'JUI94 7,˾KZḒpbk@qHSA$Wh+N#B̓pnR _ {z"ɡlSDOt3T[aϗa-&l Ұn ڿ,JZueߤOI4痭JN|2[Egw+۶ߧ|7wHd^(ӗW}k}J׍b/"aKwvk=o+ Lz s{}g|' U Aei7g9\9Fww.:a 9elUk^嫅Cd \ [ Z *[f7W;ҷ>j;2viŴxsU"_McKтԍZ~.ljf~4ŢA&zbAD%N5Œ@&Tc ze*"@^Q%6tgd"Ǒe>mzȜs>vRmɨ\>]ofA7K#Iv#?{Tr?\ q~Z½ O 6/?)y?CLb.sLc+$z gd͌yI|%oc{d-xPz3~* 55Ğ-( mGVBTn輅,Rd~NEF})ohrQ'V#\TѹSNwA﹏ ŷ(-̲횳z"20y~5".oL[sBmǓ9/=@'ݔ=c\ff%v߭3eHmN9ty mʸ3Bq~CQ&="I]UEw pKc01 =T0*}wPl#tD5ȡ@=yӟ5\&Z#ֆL 5̕Fۂ%^*w6(D=HhXǖG xw۾L<٥OIreh>Jk^t x()U+UdvEgPYw\lKpPe>%_-U\d [bd\ܓ{] 252|\~j^"Y}B$ٮO:m8>Y>z_ !|f-я+/ sfVY#+%^ 5g%0,g:GF~n35 ng?5TbұW6ugDPk}/\Oe7"PG7ma\$=Os/ BdžsVIƋOƗ1^ Wӯv};F|cӜ_tcEG4k,Dp0HMy:z 6v|5L4ƸNBo'?rgL3l 7|@dIFC`pI9JgyI}t0uWO^r<73<7:};um![@GGEH!Ֆ׉@*ӝ>{hrGG&28d2ם!nK9^&}ӚHŁfWyNvӕz]sQi@KJa̩2 Pt`Zh.Rsum?[;^SR&H~gqR ³!(tXVVAA~rႊKF Nϵ'tKQpu$"1ז|_sE|bDFYf'S+v̭A':N9,9~nP"鵖03푰)RaI/Czx!d F{D*VRJS2mSxD6_aV4fa59*=]ƛO2[+#rw5|,l'}?b{r۬m(CThi6Rܦ΍gvHxK:.C8fB LH]:$hd2VX]x(&5>Af])G@$j Cvb)¢*EF:=l[Qi5j_DګuG^B^m.%`U7`#mDlmDD&K њ8՝)7|t2r^l$Z%r7&ɟ(~>eJ)Y%S%9ܺf;:4r*m$Gۍ r#|B"Oӛ'eR"c }r>aP[z4 AX c~Ez8=>EWp,&"6ޤk?ʇQW:;9L.Ao>\-ҁ/پa\^Hϕ-r(Q *vh0,'&f> ~9 (+K@Qp"w,=be/ӳ#FpL|z|uA bX: ywFtU{ 'RM㤴s{;=t'E\i:[cf̅Y.E|7K@J΍[\8Vr<(?\Pef>_'/]6@"0L`;7N&I=qwel'w7c0,[ s9zQXid!J~?z4ly%=quw4g=#@zA!ޱ{S(Y}2V?:;F.z_&xZϭW囆-8.݌F6,-,#]ͳd3ߢ\, -}@" GS__f-~:G3H0:̇Cs5k!UǼw:~Xh(;듋7!EtGeW>,|$1`R* }[Ldp빢y71xݍ>OM߫ݱ6֧e?KƁ)Jΐy[hDn g&ZCq6(ה[ٰ`X\|^_cjH]+q8~CSn_SV<ϱw'#jڳӝC=7@rRqB([q^m8 8\sb/=Pb5]' }&mh;LWe$-!-C%s`/3pGvmNKo++T}.l!>Td@/H36k8,U{0hN@)@@Ty1O_-_ԉ7yz|QC4qhĤ. 0%b54:i"""qVa0p,x2#=e3:I?tfI;UwYgP[Sm_~N/:wo_{j2.,c7t*;@5%H|Ap87l酑v=}m暙6^u\OU#{htc,]WJß( V]+{;y}$ DXӪcW3ݱ;m#f6吝"̱Y{}5^=R@qhH t[, ,l^xE8l4Vxˣ:M3suO5!lC/w:TO% ڐb}Y,~Ƃ}!o!ă } O ,ӽu(&>>?Iui*bniW'(;eDMOKիY1ܞ^ct9kt;-6_|Ao*<7sMuuu9f%J-[}oƸxݽ~W^Z6 INHvOyqKYPW~--!QB.1~Ȯ{5 to!8O7nro?Y3wߦ~[}[$+>/}zW@"B['XG瘱T{$ID7dv)at|J-TP~Gu}6/q:ʁ>:` ]Cw}&ZfTR]oS^łNYv eY\Ϡ2r7I5Y\Ge8o~e)=|=f?a=f U;EX0iԵcУ c45)zr|m2o/#c(buWJd>|_~_ TOjEEz9$Dom?q|~1Х?";fsqܜNw7<-G|lrpRՖљߗ1v s5^$rU oO42N?W51!ϗ3=ޫ$C=|3&9ly^_|*yIy.ө`UΑ8me~71N~蔰r_^% 5mtا񹶣=>}Vq^f]ظ}num3= ɃvQaxfszK=Ylsc[~wewtƒׯKT1!?ً߉,Oj- 4n#L$')7 `bUbRQT ~fy9"g*uYe+濣7xvC?Qe[|جZPh(,;c؟Y?Y/&^W_I۫(ȣ篠MvJC{Xhv GӼ޻~ߣ%\x^oջ̻o ErkOX>Cc!~&9MacN@Q⤤>I'>H?̹XYʨ\7D=}վb$qB !,H E"AX1,<֮w]l7(`2_}LEXDm`ŝ>?|oR" cLz 4z )6OyhB16cSztzo S9Tf?b IVH$E~cml ~/O0WtB_J$NĩD\^-UV=9jV)m5wfz+ns*lO܆V{}kƱJޫ[;04xg6wҖW9PhS}b:hq0li([/䭄UK~u^^7^¤|$@?@q?yD )Q xz:kKc%,Z%z/tpٖQ_;>Croz|zKy/WkJw;|w A@qWgc]/>^v0r(?Bgh /LWshM7u.o~Dgݍסwit5^h?}?;n2g=UtF/àxu[W >jV93Q w7y # H@*) ^ "$0@ s4]0ZV`^aaQ$,5A :%1TPQCyCJ`" DELБSD&cd!Xߓe𤚥1nv2+g-!fe* (aBX= }QpPA#353m;gYFљԘ^q'F6d)084 9lϿub~AToNA=Q_եO9p!R@.a$B\HȊԖݰKkT D-E֩it]F~w~nC^;Kp}~PJ)eLN:^ػZ~G7҆ƒϭ3B%Bb)ϿBuh!N*QY?АO(R{O(Vݟi,Ӿe\<&U8qޖY(? fG.n(eQA@^KyA|Phx#}q2!޿Ra鵰.22EBŒ)tgp+N%8[v2B[Y 4i ~dP*z}'ec%r[4+˜GY}Ɉ0:BRkVeCqe2jR`H^TA…Ƣu7`$4s2%ԉDKe5 UF atKtp٭dd^Nt&86 U5N-@@ * tU&TR,iiCU%I2\\{E3Q302!'&pCAWfjóU-ꠋG6UP)s)jB$#+(wHEF`D2+T,^YD)Gz<$1*CRtUP0BLBCM 2;=b!,ExRUH*vͮ/%4ERBiVDE 8 0D(iHbNMSퟝx?/~د-vmkwxmoҾ~l6ww8kƣ*U\`s63FWx=<~E-7t7o:h_ﵞ,l/#  S 7G<7>yW%DC=x?S_Y7&8\\YtVgJw8bf1k7eWI#듵]Y0Cy:@iA9|R(uP6Ӭ::12itazE/:^J1i?d0  0!qG.qnx/ B:Z":ؗҺw, 7 { 2v 6 [Ċ"&[?zO&~8-:x{F]A]? ܵ[4F'FՌjQg9\-rvDU<" &nŠd zd d )dRv8#{Eq%Ƽ+ atIj̆$`?I_oPnuNT ϲbhWоDCГD-A\1(ny3D4c# 1و $t"j4'FXK>7B]5Pe0uF)Qb9(% 횔³N؁.Zś|Svcqg`[=ώ?ͱ /G]'elTT@}L  kLsL<($[V@ s[x'O0~e-'Sjrg{  w )IF(f`<Ɣ38:4(RsY פ %(P((6yc@ :`fUSyC[˜@F;]H1ً>x,!Gq2-]d(%<*?} Q̮cA@0ȖQi)θS&~$ٽAV,I@[/IT;6W ]TI.[h-Mś r!@=2= Y,ti3A%&СAqa׾`gb"ւH)'n%ӿan}kPcl)Uit,R&𵆝@uTħ aMKOgƷ@Uƞ,ۤlvjrDy+Rޗɡ@i^@w+h! ˱j?!OQ&  6T~R,2PMs& ~7u鮔NR;pMuo{ͿnjEG):&R͚$^Y4+U38$ &ՙqi`[ˁþaalfk>Q=Tv,R&V"]]e_, 3bE>r젍qؘ[VU IV(͏N"'R9 Uo6tusDlj&3# FMMTJW#V. p[eg?ELQfr<{R]ݡkNhWkP9wh:um$5eU[QN(hrЕ'~^гGj?['y_&%֒Cm xf`rmέ-n3dPQSs͏^dr˓sVjFy-eH{me d)WjhS>YpRLS}U>6'_k*I,eoOyjUn(N4sF/2oOk/TJp Cz28ٜ&Y #F)*/ X Hؽ{|~GA4hX3~ћr6|'"̓k5 S@[GO',jTlx) QZk6ҋ Ͻ;7 ܗKrpc;9t:1]EƔт/&Aw -1XZr@B${"GLdo07P(OٌȬ0I4="{bBC\E7Mς`Y\Bʆ .UXsR#k0YR#m5ч2HӜv&Μ kF J/u0ׇ}Gw !+-Ш1;@) `'@@YR T"M~3 8[j5we>C):Z(,L/C8M/BWaĂA.(pδ u@?ޤNKQ)~Bo<8,"xJTϷS=SrRR'~[Fd>GGvѦZ zXq.%Z==c%;Lk>I*@(>2V ^!V_3U)=˧ b Sf !  " rC2řpxkG{v/2 {'z+E}rW@hzz^:BQ+P_*Oc`|!tI6ꧪABB|뜆Op(ھ^ljO,$D`MïuĨ隋 NF<-.Ϊ;17 TKZi}F1XZ" ||k&+F ,.#s.T!)1.؃oj*ŷt IabuŊA l4&6w [W-y$UͣŬʓn&^ɣLy#0#lG`?c{&X$|rJWIcIYZd~vo_J|I|zSgvq|G:L_wLi00bV|2c}hAI)N슌y)W[ѴS>Wai2l,Niԗa504=7Z4ƌEܰ1aJemBmZ41Vx)( bb#2 FXKSS'\ycylZ9T-@uoNYꖍ&Fؔ\l?ebq[Ĺij QuCqẉȉ4gD]P pPh4U9e3c>ҿل ŕ4KjR[Xaf) ׅ&∶zub^ ]ț}Iԕ| Duoqvu߾EHrݨpz\z#JR1dH;68:к_``zʹfӔDbfҢ(rzPOi-f򘢂X|)(ALv2Q1QGM6 )< ~}={m(n&vv񴘯 LXi6` q"FZtme/7w4^W[lh0"! @ߒ⥸BқqsFr!ɱ PnF X.@Qj|ʧt+.>~$~z>Z_@NNQ'{suW?19`:@\.ثyj1Pc/73f;PܮՍʤkL njx%↷>pZ gl\źף\52̥hp7ճބ \옸rˡWMp::| AS:ZzF{ cUHMBPr[ޟ#pg)Nkחr>#ѻ|~7<FOÙTu%Br0zpo_non!zY~Iyr/u:Hr|h * 0@no7ô Hu#AKXY ,l3勞RFI{q+='MF%p;l)x{;,9ۑ)ߏί֤ȑ" p-b$e"H*S`ƛ:0ÚB׭,/.?K?6fZaD /JoidMui, \wd˘ϬOVBGJ112,H6] Ap1|fܠxܕjH)έ8F%[ kF v=Wku_N[_ a_-tn7؝gG?NNM S&huDY1/[tO9r);m0[hCSO3  EDžX? 4.iHF=7uQ-tWNA*ڦUƒL+ /+L͌﷖d0}?NM`9,&[=m+"ɷѵuUo[t`pȢ6 A0~[eWIK wEC=/Sb&JBbˈkV-zN{v6J-do Yp 3=-#el_mcsH .J_])̱Kn5d=;N|6$cUKt4 gJ eW6-:F~q` J0pR++gTheXqlpaCsT%HD5K ׵Kg;ܛ5Ş 6唋C6}a3mhdL@ fO]Z! mk;ƀ Fؑ Hz&Wi,,I]Xwg͎iQ]cÙ- 4OO;ݓE@-ErFuv%@Q@uEi/128Sq" 7 XY4R,eX.ULly.Oq얜Kʴhs>GgҲj?fA_xT"16lZIGXq'?U5 hӛ4ˮ/mNV+3D "ǜm$:G[4H$b=wcTcQ W\=|_ mqgJn\X0lKv m)F~^C$ =OŞuhK ?|7WEtAa=/.uO _a5oNi-S'+'āpٵ:}aJlsF3vqd= r$C+ wQF{ء|1O(&KgǓCBuMfe Hbht[sS"Lyg\tWj_=*c6a`2.qѼD FզqUȂ +\fхPjV y*aF$-[^c0#,!Z"8_k<NՑi">>9RRH6"s9m<=D~OS׻_jswc#3upSOQEk8e=m^PoKi1KePh-tՎN3}]!ߟ-V}dp?ǭdpw-k9\.[EN_nib)5&Sayy]ooٺ4Y]O`4:{/ qQHY^. r$Vfg/{L:8H lonLۜ#wNJ@RQmǘ4{3+sOˮ 'xxY`Т4,[y=/t9 ΠIlq: nk- -^nÂ7 F@e\+֣02|oSaߵ3:i|x)79Uhy6#::2h.#vx=/)XfeGL1|$e\#SnS-X߬ZN|^ϰ̅O[@_i\0xn C2Đ '\+nܬ޻Z&3}]s,ʩ ) ȡ*"EABUBABT!HI!ES b ůɟ5<ϗܲfȲ"@@7q ;KUq[3)Km{-+c]&[2bpP*P͉8^5L 4@BȃN3ػdG|N;fNݜ~}65bL>jzܺN^gqq#E颿t<ݔOIK=&L<+o8XçRwJ"Ė.Wzb7ɯfrgqOt,x TZo\U}?Ѳ^n=1a'渡ʲTc7]l+TI `\4ZPp\͈7C߲_tq޶9eZBR ,Fpǁ4{(cNMX}3Ʈ/g1FP33Ed}=fwLN73_fh k<.[]7.z0p7k3x⋾ois(oW.G}NTl\l8.?94/ܔJфj7KtseXI*r!JӞy-Kcf}\XmX,Vj[0|sP@4* 29wNc6wOs> v^=蛜~_RD0HTM%ҳۃHBq^x /ǍY>&DVtLěkl-^#<, 5cM 1aheal" F4f!/fQ˥?0_soEQl|=|$EVIj?w::iݦieeV=^}6?~%YO^QI^!QT(ppփ ?uz?dNNFx`$Y뜲;,Ym6Ps'H:d7f'[fV b 16`Le)pGB hq^V3ގSHm+fQpF$)@Scr\xxW]WUy`tz5\b=2J7 ,eL!zYd0z/ݺ~FoW\gks؝ߵߕi! b⵸}{mo[l!t 쏫kT9ڷ/ݒ<ӄmw@z~د:sd~b$ɞH6 L8o(YD04_A&7I2@cv.߷)`XD@Zunf;rhVyVM޺SM0PXA,,ek5@R'Jq/^};47;L C=\CpYs Ll0EC|6T6[R$0[*h!}zRXQ ڼ|~j!gܫP}P0)!&3D]?VaG{_v򥜿C@u xUO">Li Q0-%ݠi(iy#g bDʁ-Dfle@/2ɞ6 EW"0!\PcĐ QE\W%XaeVW"1BIg~3 Yى,O2B X|5QiB@ 2XȵpԍEXu$N&Bqv*Uyo= _}z o=:Wv~Gu{tar1~ǏGYx|53U1}Y-:2k{v巽Th@|Ex .Ο٘lCbY 39*-Ng{j)ۜ0b1`PJ tPbK,/{߲3@P;r|C8f=Ӗש3uS]F4.>?GPe\AMqAـl%QݙoLs졌d,0@&ds~:Էv^.oD+f<ߤ:5 (DguZKel(' 'JGǎBc qf&p(L`'ۇ-N#DD.tN9p BnY&M1$F,jEA^RemtK%hgaPRwb4-P5K@(kΙB"LuRT"$1-7:4bgG1@ ^Đ@It f{x<;?uW9<zi[cd4i -eZ6H9 ~+wG U)1nt6MJ&Yݯ=zMdqIE{[z4Z7~Ǫ5@f h'Wrf힅c==owB'g0[3se]#ky>IZp:/ :lS r:JæD30Edp$ `jȤAO &sq]LH cGylllr ie;RcI _SfhaL`ccz 3*T3<oz=LF^{-ȴa4lkK84ձϲ8&Ѷ^߷5A2vfuok{º)*&Ut0So=o$,w:7k”qt\miuF6mOa7Nɧ0O.?.Vj9 z.\832Ƞf΅/SaiɈys=>%S?(.n" .#Q|9< .gk}2dL $H>󙳙:Y=9`ZZ?7&:&CVЊTQ{_;Ꚁ-_FڋWպsdblEKC~: (KK (8:v (A`IꨠפV*}:VgvSӞ˯k(!Y/iΛy .m*qnxNςߣxsvxϼVb>*Mz֠]/鿏foxz+irZ?ۈkG'Y]m_T:CWn/CcI_EMH:F27Amz*I!ȂH$H}vLfTr_@I+kw=Sv5 HJ戊`bCtXo#D=Xxn2ƩG{1v+ ^I9/[% :%]|l}Wz P |!7}%FFg)t_*K=aLP_{aDR ~]tjnD5kq AZOl?kzex-eoDBDL=6ӅwPAYZ~Ӧǽ8QsZ)ng9E_2[B - ,z#!6q?E_|7pYj0&قPҾx ꧏ;ٻN) F9M]OLűd;ʳxKFBqKbǧֱh)EE+ov!{rW~=cҁ|{f%ӿ!6GLHQ>Y A Y?.ȦU c&aW&=f&AJ$0 Lat@Z"P$ FgI$^VP[g~^I WGˏӶ׶*Jac*0j\3XI暼m*%%^wLc*H؏Acxa)>NT&=5&sʺx%64upP,e ˡgK~)eN;!lU@BY=W'[-:Q锧]Ʒi=oQy:q||rt;XE7ܯ>RTR]"m<{}o9XR/!LJ/KĴ<=[O _C5fRk~7\|WAy6\@˜{N;)\XDŽ23 >#u-IaB܈wUs6)95˻2/~k'Ec,Є4a#C-ug@b(Sb#ؠ GRg6Od=ai&g4f<\Am% `-X_bxy$ `Lч5 Kxznpt a 76~hgIyP|y tqNBQ*8r발=E^jEmS^a -WE4m Qw} J]ւG2ھNN_.f+V}<,׃׷ߛuyI ?sl=1㘆@sfbzy]r|'bwq%#+LM_v8迫5nbܙMpZ?.Uجs6} V÷8;pn[*1%adwl7v ?F}c=Dr{h_$Z|6ٴ|Wb[--n7]+5Ey\V궞>ɯCOض.9vyG?<9ZWiAc? W96 [?J[ɿn滈Y @喣0; <D zҀ+1{4'cCS_ ԛj%vXLz=qP7䫜xxg> ډ+, Pwˆe"1P_(d@C9F.PhPr3%mvjKLXjYcmz]3P}S"F$6%35k#IsDo96-մ;bdzߎ豐8\xV{Zg}x_bRxԶuKgk%[q[DëZU3Q~f|S̪S aV;׺dGq6c1AΙIY7ٷjz]SQ,؃'U暽* 'w'?Z@Wh)P ,n\ 8@ cJ6WǺDJPB& Q=ٹsm|5 ީ m;w/b:P-7>Uxe6d(P>-ߚUYvJ}1][6Oߖn|_Kϖll W9UfqSul|X>ZGEV@PIxtЎ? K)?#?UɈxdZw3^zS \~/0Rq1^{$ge#NoGNDqY4;Wz =#fA[wsOѹ}io=u&O߁Ep<-{?z@r~K[6{78ObS邺,G.Y6]|_x#}̙ G9V(^U3A#9_i(@h߯[!;?Z?ex+0DBǶ2_Ie71hZ MCO)R7LsY;N c ̹-l+ϊ]-isM~_&giZw<7UY!o ̉%+z>J_MZ:h7j,˝=|pv>Zh/geu+!}6K3j -2oRp.HVQ"(ySG! [OA \(LP N5 dղ24QB1ǑG_{_=ސ%e;*0J+fd+P"9"Ky`߃IG| /œ#$z sESq` ^n=~:HYqJeap- H.'"%89M]LnI5Ai,b Uߪ`*Zf5z[t-m1߲yJw"$oY1`8t~*暩/\(R 4ڬ2Ir8ՕX^%.kfȭwARE_ p#϶9`Q Hyueԏ5YFX5ђ{ Y&Z,{m| O T%R_)3N.R_rVn!> Y~:Cm%z" Q!-Sh2Z9q#%j2Z{sof-KL_< C2ȁ fd4W9-  P x+E":;^g4 Vf]/ jk)FX~N;fUbH m&D2*+,hG(5H^ fQd (5B%qlJ2DSh6Z/I\'b]ZtRҜki m9ihgUr vrPatA;tz?]XlWa0]R_] }1~"m/icd7ysE;- " I$ fbn>)ک:TC<I}eK3+_a?й),2CAn-2w{nQ2^K93zl ir^5og+{zHCyo'*f]W5|gT`gҶg_x%}sm%ot(\y<: ]׋Kmr% {sv~q+:yNkI Ix^y1ۍ7̗ыܾq-u5ĵхWioݷJjC?;q:v yمc>~V9u>/G»8eoMԻd3ECr(f{]d7 ؞F}dҹ[ Fjn/&幚_ IxM>t^sWͅS EPK/i]Y~fxRi0r/=-~4}_7CI`z( V%WODB?2ԝJ_CW^^'MͶz38K<,_;Egerߝ=td-dGBg?nWKL7>3%]زwə|1tn4Y/KT|5zsy xKgM'{K=z{嫣q?PZןO+d~3~lG{?v\w|u 9m;z';#i8u)Yۂ`l:$:BFa C=W8̾U[7͞vW?_L^[`HtK[՞J'ߌhS:|6+[QE[nfy.ɐY_pBw/Q\4k]ϼBtsb{<㻬RHLD zS33PţH‚aO sݩ1xTJ匞+/8)IejZ0Q5]kuw\F K[Ʌ&waaV~#w.z <;gQHQr? 2u'[>{c&j^kw=i:u 빎R([0o="eN 8SD6u\v^S[{:{Ϯzgwӊq޼Eޯswhӻ:qd%I{O{{ӥvΛwg7_x:^ t;Wg]޷u ps`m%$ݭ>-}``FgMt0@n'veד}}nۻp&ӾϬm7ۻv{xy<÷>@׹Ywpｾ;R}|_}^}N/K9UBPT %B)>@Ɉ{>Zkw[GNo}Ƨ2љvWCA%VwUORk6,"[EPsu=BTT]{յpxRzan誌OCwx3v=Bl%^yܷ%ë!NWפTmRAIگLooٝc@UDv;fJ#6s[}>mM =O lz\枙:"V{xhz$L^zϾKׁ(=|vwqT(k]n )@maί k\OMkfxQuޅO}X=aAywP@۞^hi(^avЊF͎imUwIj*P !;^{6=8umg;u T 5/ltpn7l4;]s,ԍݧ{E^{ nS7wמV/n͍o8 0{:G@2Zs3MW>ϯr{|mnVۻ7׸q r{kj= KU-qшh 4&&ѐ4Ib2h  4j4 L idL=4M26ɤa?MOA3LdDPjb @`0#&)FM 钞i=)Oje4Ryoqp4Z]R̆Afi-B 9Բ X~)??={S]zPȉ.#Ma)Yf0dH?$_۠cvb-M~g׺왷ҡYM}ā1f"e9?*_Y\SvSû9WaN Yg$gM)R6p8e B yIߤ@S_]tN-x]NTfBkH *I&Q}X;߽Yj铰c4Ϝ]Vm|/wj5 ZFYLY um~(,A)]7o qz# zQY 7KL4`==蒳lwv A!@ u,kW)@q%_9-t +t躗Jq'}Vh+z D@Bx0PsTb% Wڅ{%7<&P&\ d8#>AA%5wbn$nHx0 C&ENu.w =볚" #GE )ԜQ4\REI+!]t;{5P0;' KZy`1A@0Q8\ ş7XXSș~24AWX=[zOQ~ދ`Id~Ȳ ͎2*rp`JQ-0]l>{@.ܻQw[n>B\}⭅ݰLjB'~c7M.޲T")6BK*,­ͣ6)tbwnA_3, ;?M\] k5p˰}>0h]KEW+`AM>u2JO;;˯*vv%^k}FG/|K\}.K5s3_=%3og2`6CVl6$r${D:dJh1u[ڽ#!X!y?aD g1|Ulnẗ́hX|ֻ᯿OMZPX'y|@zvկ)Tze+?m} [qrNwo9Td5u= `nZ#v2YVK ;6; ̪Q@#Wz5ɡ iNxΟ a]P^O=lNaB=# ,}~l]:AvSaKw4&yqx)QZ>7ó7,3 ˌ93!buF j:k$eOry@ EOʕ4\[͵wIJ\lQ&PؒՅtsogOǺŕT WO h?y)H CCIYxhP@DE>1d͗tu"@HO)ħ٭OoB`gt`2?FDԋU0bj-ջj ѷ7}"b,B 9@~Kn"4[iw)%8ѤvX$C)x md{8biGe~hs} vowK'- ӅNl絽WHWSn8XHKKVm: a-$C (wLc h{[5a*6#:[(F;{g<کp@:2 Mّ Uɩ]ʴ !BqRN'qtmi[f)7Wf!b-!G 'm5q޷(v6!-cerN Hd!kl^OvZӴ58"zRv-),mz$e硸>Ԩ hao:UcRAd7ISvuq{]g3:jcjs3NMac[`vgTncE$Y᭽٤F؃Zc_wiy,GA!HCV| ze&1a ߦ nAf4>kI5 e\ZԬWŒ[147 rȒlG:eZwx¤$@d%%ߜ{fZ+NzBX$-\m4tꐃ'f`]+d־ N3k"&ή\H*CǺ-F^f̓U L1 㭕ƀ#İ!9~u}׉jhl5%:a'fFaKDgXGhh1W)PFf ),H{+W5 7HwAi iU E>dOV7c4 Cᏽ̋mTe;-X+V\$luX c7n8g˫LYj: RY;|OuXV;d'tCE@K!z}C_wn69Ќ ]Э3n>4ݳ;z@oc\ye9n .Mc/HWS%rS .j]ֿഐaurICXY)R (m_0BcBvF-ՅrXEZvIꪠ*$k!}[]UT+T(muZJA,T 4 & ݷS5t5.QUɪ˭4ʫC .҆n } @N=):sx1xϩ8}*Kh̺`F foW VF0dh KZ0Zաg\P$Te^qtЦ|wjYxZC``0qٳTi !,бߤ%7~uӂ>ҸqaxU`dܚд݀*z!D7%30СmWI:,7M"F v X 3"Ff2 r((D2sb% 8yy6ٸM/n8~o|"tY.`Y(C/:nk9,(`6\!gvܥBh23#&D]̡{;+.ӽԳgn ρtu$jrl1Wg7c_y@-mjOO9kMwߛ]YgwcHS(*mŝ\ףTd4@mc~̻(LD%$%U(r H_n/^rWJ?Z3y|c-Yk? VZ`cۿ뇏gohP}8(cnuT.,_b-~” ̩ߓ.و8Rf둑Ί&$ēF^+ 1d(Iu?m:zpݥW먆T`;;hkF(QkP mߩأ54/=̢ھlf")q2FvG[k^Q?,ԲlK1e{0d+n|Wx|``2 .i\€XErjz,= ui \N_JfL)y2PC=l`H'9[X_`|gq/Gq԰\g|rm]dOvZtmhyT|Am`-R=vC&2>Sm  VBuqLbFk<=̈ꄏK]z$.]IӊU}Sݙۻn:\OpٖZ(>&MŽc~߯=VihW5ZNO-g3nF ٘u{5RhQ ~AffkAU}T *Z wuPq'Te2ieʷ|_n!ž=;^QRx7׹:uֽi[03If z;kI(YUE'¬ER2Ջco,9̃7}֤? O[Wkqr5ɛEpc A2jbFZOG1i~Y_*dg6ƁM9z3xxnAv}I)U3[W"" Ht/} T<-;wxz%bwp桿@)%-aQӑ;`gtx]J+x9f e '0ŵX@p1 ק'x(YIO`RشՄ %9)>hVL`'1J 8f>U6|JQ[Xx5%pBA2+Qt#ˀ~'nq=d-5r:,k'*(4OٞQ֥ 2{,1Yqq3nR/x#2W9A;sb-H'%k6a`@2P~v1w}J^4G1d@^7k#u3"&/޲D}&u荏#As")cztmd ^*OP|qq'' /pe]YOJeZ܆Y7ggXg4D@IFkq'P{4N?֧HTW;9OsEz?WHK>!Y=xjjnڦZ/. 1x .}y="Oٽz~j s" _1C|9 ˠ-[/Bq.U)[_dvY?eolR4Z)V@ν!KRJ8z:\}0b >x޽H.2pb[ϠI9&CL9f5!tN<&=yBCyANsrV 3F8(U'_1Hf%J=F~vDh= }GC]j+Ӷe*妩`H&NΪZIWA8lˠ}݂к{UrUHsgVQ@]ppQ(2<됯CVJﮁEB_hd6I&ĀX7n Ap8Y="3SP¬&Ak}$;E zŊ |m?Fwgz~ʌ{ޱL MMљ}GvnVMVm=fthBȭ{4)Re%ԩΡ$9w598_to9e0PP1zڦG>1Mp(O!ӱ'^9/HU*mzt떝SWQ x:[PQbŠ4i HTᎎvh4߮E _z)CiYcEG*b`"c=K=4T8<`$e6C(+NGgܧK+@<:JɎ_eemN>jU̻ˋ"L:oOPpfRSuD~صU@f;9Vc׃oOR޽äfLYePi떱hМpexY+}Ԥ)Pi )SMR ߫t÷uރa]~M XTE{"sӴh̊k]hXTqlދ5~FKL̈́X3gQG<w$ ..<rx0A6yl S'P575up1p67+ #\ݎ=6~wumf8;"4,ız"֢$JK:^IQp䡫">T5 ~aC@lHpF(;fe*fӡK]F9w6JPF9wG~u@GJa31ƣdfNٯԺzrAqDMD ji.;<4IdB lSYdg0SXj R!*s|\x 5|'T(bn:W:P5e::}|k.Q . :+e)p@Q+֒o/PScWvzy{.i1C"PP# !${-J@<ݱ]FOt."KeԀ xAb!JuiV\D.4 J .@P&,P0(o#uS( a`Bz|qjS)m],JHС6VFgv1^r0Lgl,Dۻ)2(I8"$no0 @]dϷ㳂L d7Y6CCxDU &p'сzsT#Dy d;>r].9rgUwsM&j4#̠ʿ}$;L KB1鐓A21X% \4d\tW&4&$YEX*hӗr&|A"4OS{r H]|V.#[zy \Mb󌮞_ɻġ y~Tؽy<*17''E`1_NPCdǜe Z9dYP-F=.e2=i;>H`^RN!@E()ժ^?,;e '~p9E˅@aoۊ)H::B"Aі,_R8ݾƎ.)>P=x> g{e0*45_ aKݫm-"kK b#.4 {b瘬ͩ'7?Gxy>[yS;Oҁ,Gtr\D~A<2ګKAKB9 2mt јyW (A/43Ne)YX-)B[Ay?]bfqvjB]ZS,5wD/qSӤ(/Fr-aJJ Oi; +jpw=d<斁KF8ߎ_8a@"0 ]aFb0 y8cו\ E((SǷu bpCH 95BaF 0ԅQ…6@:kFTU ֯EE\M*qc` `&uwiv_C>U єw71 k6J2l֜U5JPnʉXw4 ſ|}pՊacTڄU~6 iPgʏOAV}}To*o$WÖqTpo: L/5c+ q"e>DN-9=s@[MUI̚_aw/:MwOn;t ͎ަoVJ""8X_ W @h,CmM0",L n K4n@$ Ū筣B)Adh,bē&JB HL:R]6;O7j`L40THDnMWWUajHAF7@ IZbn8;DyN)U-)n-[kժEXLDMWd@AIw!, 0ب4,C+;䬳>X sy'j(7<@r(a 0ˏF0*C<<Q[߁ TxnָQ7j752xd,AtvPN `>Ic .no,hVǹnP' Y* gm&k <"? wd&AtDJ)z (Z.80q2F0i[5AA '{1tIE e$PB;tuq|bUXf Qf zŰZ;̂ss N_$̧oR<~)̣t*}ZSd&Nۭl3YkB2qESQi=\k`4g!#14Sy6i|!8thv[{b)~#lGtI|G@x{@ټl*~$(.GQ<#5@_*zQZdxc e3/]q)90쨑0"THz6BL0J68ՎKȢqu$"BI嬄/i]c+\4BrU"MZWȋpv̸W;"i`E lR-fA( ]&t`!Y֥Г; qtQ_H YèQ41U٥Zq;+#k!|L{%16K=ES3'4.N=\YnHJՆCS.3>6j d3ŋ n %`'/ϫ "n[EdUmҰZ}U ;0 Zk|nspx`Q@X^Wcj;BH1 -3$#e)(ˇ:nFz؇oEb@̞&xO!SAU8Kyq2> {md!+Ō1rn$KbEu|7=s_UV|Wr4SA>3zj|ðFlˬ>jχ?n]ă#4[! "PAgeZw!9|u(XyjP Df uro7&x퐤R c$r4L1t"g|DIo W  $`H++QnX Uڣ+"<`ab!: 9]eVL8T,}dţ|>ǔ8e4 N!#\ wqPfD%Uf_5sGq# :G'c>x=eg 6'aLݗ#qtu)Lޫ[B6X(gRmuٺ m 7wGBX-:4^,'-NI:T)aX@^iD[}9aRuO_9>ТR6%mOE "OSZ mF2߭L!Pn[/\Zr򬶑q,ӳk+`z2Ӈ@b%+rU8h!4.?P"EFι$lFŒshTMaIVݕ¤[d4֩B^uDVS`@(YEKMƠP3\.V3ЗP'߮ R,mBf[9~Y7ɸJ^>ؿBiC1@Sfpl"oψ.ߪ‹/SjvijBJ~  zw_= HE:r][.m>JTtCQZ|S 'T %P|ʹ`VsN3h6AyoXD h$֮V118g= `A4$ԇyV ),@ȟ/a [}hgO HŌV bpl .:i(D 5XNxbr _,+ mP&I`:(6U +X\czS\KOABPcRZ`#e2tӾsy l|Hkya!3xh>3$l`^r.@ͽ4X e{94L ׊ 0mT#@0o|v Բ clqN5}yFÆ-]q[f]+$(HGU?1U* ^xokX&.GQX8uOx<"@ n`L1jxwT܂Ӎ" $M~0%XQUQr[Yô 9=M"t zAcRŪQ1w7+3@gp7: }%8RAE) jUlUQʢX 2,"d,gaKs!h q mj˦X W~_FXÿ 5z5,*5<:oT7js:u:" c d-rY 9Z -Bm/=;/h)K `ljK/Qv/ K 6\ {^)FX;PP[=V{+5tvBQ@g`癞HϭDmJ.{ ξEt5< 5Jmf.j;*Ff Qˣ幭޿qqLqගIJ9bV}+|X `_A̿!-.4f<}*,O? 'vpuEA{pˢb.Ǵ}vbLw݁Z\;!ᚸ[[mSi"ŀRS v] J/rN|[j6Sy0^P 8dǭ̽'Kv}g`t"> 4n{ڨ]1NGY d]gTh!;k PX"o6c^5?zKUJpʲ9ˀ) #qwUF}#KMW|>rgjf &c2<7K7rlqoOqW%RG@<jNp$!DBoYS9Y*!sW6H@,]t;؊+n/,^u $ͧ5^(f6[fѭ -C۠/ F/o/h:7R"4nv|,q5C|Y }Pi{wtsں幡k(Ȳ,Ias>ez :<"Sq"{ܘD` soL;y}%\ޭ:<~k{6EdX1lZɳٹ[~O[{|ߑ`Rl/\AHUfذ 3n@u9k'*^_ |MA5AaZliq^W[m_,-Xs:WD\V UF. 7$BݯwfuNX4V.czKܑvDVJ.q%MF!QfUHkUX]$OBxٔ)…6u{0Z|! ԑV;-qj2!E-RN5 eyz *b7_[m|R=s <ûd.DzS=_'$ mĔAʽ(p]t6{zG,́ݲ k,`çR_U\a=Q:_2SʍIJ|r6 QGt݀m@ʚtc{1";(Kj/ I30`a>~Z< ;+Eʰ e4m=⼌Qeg Jybׂ5}= 53B0tmIvY;NbdQ&䶮i#:%/CAWY=)H;Jq5S~l6:p0UDժ<ݑ&y<=gf1TF =4̪DM̪ [ںÑ%X̐KPy5Ugm* O׫fvrE{zAFZs坅0Q+\"0krmsVVskWj֥a "kcޠjjZkrsiX/X1W `(=F=0M;*&F*BB!uJQ",ނ 2 u~\:Z͕3#eU YkT/*\&$!r# 9XbCQc {qLMTf FC+p0SEÅheeDqBx *  W_xVl^d7X "OARMo/D0*: m/~ꎃ -VK#/W"ej!aboe9V3+% l_mxI\ EX*PI?R)Ȅy`s LU &F 0J`Ej=wOCèDs0fvt0cN (cK\F3y!p<lk!f3#Z`"K)7KOnҞ:SKwxǡD=j(-*,W䛝ctӃ0hQ@nRv%1 7oݎ_xr?ܸp󲼭@JNy-6BE;;$Um1Ec(K 7+7]7k׫ԤXGsx{}OTl $N &@"@ @8]rz Ũo_V,m3271  sA)21bFw/nbM಍t^3t@`mQ15&\ ,6ϰR .L}X'l2Cl4 ?u 9)LgPڍ[ȟf$*U n:O-cbtT]ȱ!Ƭzd"^*T_o.5ij2ҭ0c h(5T+eĆf@cvCg따'(En88>U͇g~j']M_! seLޢu^4ّ(5 b(Th ~e5*t((PP$wk&XtrOsnK=X^PW9uG[b.ce΄pM`Ufd 5kTk&z?/fv Z<Ie9Fӆ?1[oo$Y ˾Tع;e3ftQu ֪: } lk#F_mϊ[Y;Sۄ94f&Oa| |_M7g6v bM*Ў‹Z61njAc@g\O^=Y*<<ȁ>sc}z>d:uԻp9IXs:CMb;ΔV[(@aBH~LtgDuTm6'p|.jT,v#RbGĤ!An:Ut.A@&-4{`f35QMv "e'}{-N3OwǏ?W',J!cKRSp3CXJl©ǝfF Z;ˉqN=ͣ4R4QAbʉGG]v=io3g̺k=  '`Zn2A0fUFZ3s44w7I~ap΢lqo|u8e| G{ϫTăgȹr@ eHk6m^m)0l~6}Rh}Gj/_5%ŽXQs*s Vy 0KJ/?/{b?d*Wj`P"hgdF_?q d|;# A G"K+fJ;Rɾ\\XC@6a:~;=,CXҎR[vA&ӵt dIPsΧn﯁nY˴L~jU-vs. *n"3 [c'[DuNjSSձޓtj< ץb p)C{V%(\r @d޲~@)SӓU\Qr틡og(zIїD:aBR]_1՟w:+ 9B`ʊ$Ǭbo0bBL(qs(뭿⥖X׌$cwzk"ߒLjS^)G 1W,_fMj9"$ULГhi( qKOSŭ\Zl[-Jv6ڱu<]_"-Pt/ %4ѯ[L U'Na Ռfdl)t&֗mI=rK+l[:ٵrVs"!ahjU߅YIܓZ89!WpХ]?D ~..낌|ARw:Hά 'ZUc1iFQ(XAS2)0BptUU 'QSrgCgWN֩E #xer*i0yv;w;2{*ūH yr<\t7P&uW;Y`<ٴd_1щ 2@gt=/K5$A~ȈNԑ)(njrk+B͑ink\5V(%l{qP}MvVwAe^Sߍ<7B+?h&6h P= T'ٱR5|e{blo_gլ!dϰ7/Z(3I`™9 (&;pIB}d$9LT|"Z8$t$Q}JŎku5㬻0_\5MCs5C6Ϊ{< "=7[y֛j SZF,tZ~90[@@E3:z5]&9wNq^, GmFqZ3]`uWJ֏R@D\^풜 ߵZ "R/Y5 Khb|zg&E~JU9j&jmn3y͈TiJC S26wg|bb-_0BAJ|t,1{PtӓmFƾ+.Ccg>C@%pN&hhN~uW 6egjNBQ:|l\ _fa I镴R)E1wWz G H7]c{9_.u9CZ4E#wiAQMUKJv[5T#S[#5u`{T?4P:+KNgxb+qƸQ9tB#4 j=wZ0~cl΅{)Džm~!u,YL*Y 4Z#gpVůidȭ?s @% \@|en[0 j 2|։ A]KFiEw(4@yw27]uwo^OGҏ?΅2q^~vo ," @c$5Ktqh Y=} uidmf'HXut╍ܡ[g tsҔ1үg/|ĶZ`j%|~ZBVnM Xl-=ҀA͞qDSo'b"WEC8;>) !Ru>¢k9BĆҥy5MZnD8$f{𦶫 K4'2ÀAJ%>"h5;E`jDU8ήw7_{j}28` vEdbUȅ ҉IHxiWqD9E0_;!Hͼbiq3`RYڡĶ5/F(wDW1BuJ@ΨB  ^P2PH+gnaZ'K Tne;T’Z9]Da<ϲ|^#!$ףqnքa^%f.-ƨ InR6_$vITi;jR[pk?[P\;ͩ׹0k/@ %lr SE/fNmg`T " #**C'C6&Vov\ss5 Ţ"Xd% Ab 4.4PayVNٌ ^o AuZV[=@Ѳ ߒ()=Pedް/2 kD< xBVǽ?x4+N[I)EY"3׮}Ԧ?ow*y$"J#^%X TɥV{ް$ӏ/iKȪlo>-S4mg~H=Q7%`^ RYiTm7=r9e I63u ,J; M{Aj]>Q\B(!b;-_KN%*@xa@y " =4_3ބ6|H%cİ+sZU1R)Gtwؙ!9dak*TE{hDZY|Vƈ C:x1tu/g"4(TXKX4wqؖ<{^=%N`AdJr ɇQ(K~dY=$ʸpT)C52}fm\rɀ18pXd`G6qI"nyT|'_j}ut9D˷VoH=QT @nbDjH]7C~XXgaF 'Ⅸ ' 󕼺.Аj#3yThAGESƬXuŔ\ώy #˂S=\DW˫SfmpR𭻛w6G#kێkOzkaVlú = \M`IQ/-_rto6¦z:1N5h•*q}]baWX'ԕ`TҗMPMm'MkUfaZJPJԚ>"+Le 4įV6_)vǯZ;K|/OI4 HTU}K`R߇sg~ZIH;HJ FVDDmkYתz2bXyyC(1X Bp,,ݯ2aMƪb*ek~a|wA_}˳@Bu;d+f4ú֨Rf?WQڤ~2ȧeyag г[\J'p:fҹFNXJ~TtY(e^gʡm>;3Ha @)'/Bͥbזnz"C +2RūS#Q{nMnYa:!UcTa'fB'` R)9&cĀlgg&xw- QT)TPJUuQ8'sʋ#^[7޸w~d}NKP ""BdD^ i x]u7ljƥtxmkw W;S^jاp}Iq,/jn5[^YIVD)S\)/ҍjz^P;z;aXiG5Vv*Zԛ_Pt0{/ӰuHEzT= ;>VײvBfu6:Woi_o +/-j`rPwڰtUU2򻮫^NO1xRǧ7z6W9V掠is C? :JC0=aC=X1y/l>LȲ,jA{[s0ψ崍=DW9vZD7jVk*źU:%Q8Pfq8 v8f4=AǙv$ؾv*TL9 iihH|kHB:@%& kTa3Y*TM^NS59mѶ*a `vhtP^lOn>,͕viǵ7KW2KZ VcU@4#kqs&챮c"nRu D\QOKΘF8SR w񵒯G$!Ycym q]Tt:-n{rڮ ^6tqRذ dN[ͦjULһ8VQg:Mb~(X[61?#ZĽ(eOh*;aϥ\ /ξu )(i߸`L)ϫǁGP x2/H]#f'N=YnX+yӽQk;M*dC l [;巅VeZK22V+izس #pwGxrR;߻RpqЎA6fxzdv|أ ѨW]KX R4$jO>̇Y΅|_55_ĤxcT*g5-Iv׾'n-u8vܑX)7{:3][]uUZdjӒLSZ뜴*GBo5Biճ~B,R+Rr"iQz!pG"Ńj!-)R)qAfG5ev [,vBpWM退;n |#"U 5$@ .a$Ke!a$!H@<@:B!P! Omb3uXUhHl ULJDO 2* 9*UWCd弔t`sq{ du16CO^:AvZ:xWii.z^}~)B@; .(|meOE+s!!{/D_]^[bgNUjS.g_g'{eh2eI8=Qs>fkBr5λv̄[ @hֲqĐ!:V!Ѳ|T!tϠ|TwipSFjjR֧󶓻sw}hv3$z^+v)=v.1T_:|2D8uwu.bѥVE_ BWdOkHnj$٢vE0Yʻ؛k=^=4/g/x4dĢr VSuTg ޅ4[veϘ;t&B G*V2oA zHB 7i$Λ `HRBahqܼ;f:FCfGDou;4wXynʻ? r4}Z6v|Ӽ[8v>PP؋q))zs񩳃bĶJwioX̝l^]G^uvd_?fƌy v} E~7z3vHŚ@ o'LjeDgRHbkBOB $dd4H"ɄXqC(1 $$MWwXiwІ{'O7S}BB0X6{ohGǗG-Yi?q4YvFn60mmH*9gމyPcc,Vػ $db(ݯЋLeo-}^!0|}ٵTuzjw.l^$d3 7(x?;BHd!76I[tx:TIla! !@8u4!5~fd }׵9trlOԅe6,gXmA]. -kr,oF2U[iʻ2AYK%7)YN㴩L4y:fɗ66xq/^ZTﰲ4hL\\l/.e:/#-a;6 ;%BnCqDP섆s;ݐ:uxܻ_Bקg *fgC Ysqu;kvwEnH9$]I+=3O-Fye܌*W(Kl5r:焴d Bۺm3Ӎvߩq7 +[pKN K ÌU.iq#|˞d3sC\#;FޮUsU TOu^زVmECKognۣs9A av'2L8Ҁ rP@q!IFyW qYs4Yu ` pȃvR2+{+E+PI$Iڡ~uNfd2&Aq=$D ! ȲINY;hԛsms4kr6շ9EnA[ΗaJPc⡾m](p&]ܱmk<@Fm%ѣ+:=ηfVWX.Twۖ^xRWS[hE,'~~ٴMd-=h,JRzd~q7YN{ mJIdw2[BC4&$/C[A1w~5e@5K-[QD@"@ Y^K6m B,( @r C< ?Gù(xi$nD&%0 B!P C%æ$ K#5yxkQˇ{O[ 3 bjny{Xa)|C齅lxs]) oŇGSP۶C䌚nX޶%r׊wŘddrdtl{i#Z*kV30hc Xu"*{ZHX'Q@)M,zKXaSVwu)bZP@D;ʝt3au%s.<^=+7ZI]t (<:) E.XY#~w+y\r@<$KG; ϑ`+^brm4{fD) h @6k>g[ѱNӿzJ:  nѼKvHXs7-h!j"n\p $ tXI htƖufF/EYg=Z{M+P>2yW g|,Wq`ODVQQ!-;R5Jdq&q0ȋ"&, S x}Rt:i;n[JCk0o!&WT="y6~g>}9uvjs~3︸X5RGbEET$6};xuz{'뵷ҷk?v- 2s;@GlN3WrR@t 3H5?}ԡ֫I{ۦCwa.kh5 \].V̶:9<Ey3@|7ۮųjJeEX9uv<@by^:a6OX&&%WB@@d텸zHu BO"(PF(#h%-wl@M;0d !!w>9̓E + 208%2HI&I.VS5ٹt}+Rɱ\w].ӳ9 ~|.1s\TD,c̶ZnLI40D](gط_ n TDDE`U$™b"ͷ[v?xo{!!m+9 I7$!rw]Nqk͉03(!a |CC=F]eKRǗOs]fv^H@2U2XBްekVp&D "N[ MzjqwѮՍbޅa-€xL@p|O_&@W S9[Ѷ}ha}`nЍ%Q87AoTOFeSOvlyF,VاP1V[eЦ0m 3Ehwڏ Kg|,g$aԪ`v4XKrlvyx9.h[ +L'쯬F+[h{=3WnLIrrP͹1Mˍ]-MRRHh& ,f2S@E0eMT&fI6L?qEPS;-Bv'b@qUK~w_:02_"4abn1h~Yvx#xA !`I)7ҡ 0&uw>^b#39WdUQ`͵q=(9ӝ̎(BwM V].@{JXJQ$删PVO 'zDuw{$='em ߎkbfDCq39n<_zT u$lmo/M(+ 9:ƥP>{ ݽRI +BIWK QV0$SEn8WڇٱϝuZz ݫEE{Z1&Q's}siCddA31bR4!NjHI|53鉑v<~C?3ܢ! \r}QM".&ۮ9[*uc͹\,hr\F^ )p̋A1-B M[IH[$.nnϺ_m6EF۶{ORʻo;vQI GnUEE_CzŪ d M!a 7,7$ U}Q~&R 2/Nc]wՔ2FhjfɆƑd))%vrh寤ג-V#[xŌF}s\%1aInB OVbcΛxI(  ͇d! @d.ة .[ʼnC\x 8Ua7&^)0nƾuP >zI6BbK5(OZɾqɌ?] ғ uZ>}^(0!<$$mm k%UZToy>#/> V6q#7ˆ&b $'Mx{:,".W}=U+T8N֙(^I n 78ݹn}.Ī"Վtr뢱ZfƁ~\ż}2")eE}yW)r^_||5gkNy&d<o9yהXL(ܲtf"V7l_,7}΋qbȔzWS2B+mz_]ܘ<5:\SQP%rwvʺ 4H m"[J Kd=¾U!1wr$;{-|kgbQĘmyz_r:.$6"f1&D2(^xKefHIX\tPw=8~珛(|JAahS+mԔf0C4lu踛 ܝ׮qěCA^Փk nw"1 XnϘ)s׫9T`kt!g04"bCd?ax>:ؚ]K꞊PMt9rBض^{}xwwho#7s_Vk#`d/W =MkZ24cv?[y޻U LRTIF/K3@7E(]R]:hF9݄u܎]̍,)d%2j ݝ~G ^#J$Tf=^%jŶ-QmmV*X[EogN_TZm( O>MRQۺi"e)]Rg/T˰+eϺ}gtRĘ2 LfO83ӯl[f}tѾ+_o.6Z1 p

}wgH>@BܩD;Τ,Vio!QTIi:-Qwؿ/, P'(]FӱK`61WQF*Z,p9dq>hYDQDx6Q>Wv=M|ƒůLߙm?\yO6`C6`$&Q r>WmtyN3btƅ7(˧d(ֹۖ󵼷 D۔RiA DCk幰J+&6mHA6/xL P F uz^cV%ߺrէ~1S$>WŅ%5JiIdh0MؑcHBjXb*!6(Qhd $& h"(d!M2M0P aEdPvM)+\ FkUTQz}u<5¢{Be Ȋ+L m*&&µվlh62BKK2̼nsM2UYXPǦM~<\b_3˷d8AJ qh MVOa;،]s12'-,/^~"BIͯS-ZM-:\uâ jk lW",1FQ@ 04~~{N&q+x( EQx~eda ;k7ݾ:mx8G.ͼ8y9~ˎEE9ע W8q7zaiPֽYe\JJbgÑrtnQ5LDi ʮ,mQKclmːV4aHj E-EMtG9%ńLbQ1" p:FWwZ0wuûNnWM;)gQ\FJL52dw<˓1#-JB%z8wUcdoR_@F*66*ڊ*J,l(LR6dQiYRjjU2e H:zq8]W[`FS QAq@bm5mU-_'Edmf洄z8J8gd$XB Rq3[QԺ@uC+AR@C|w/Qp=nTdžBuŪ!aL m8BJsks&=À>떻x,4]ʍ,d+o<a@&lً(IFQ)1 0, 9CHi{}imrC3HlǓ$˱W,i>׋enO3Pjoѧ]pV8\ \Rѭ9=lX'^cZx*ճ;RY=R`jot{nC׋B*}#HN70_Ia8()]PU.ԯYzp=m0XHD/<.j+tco;F+R{չ˞Rys<ޚ&.('wN}rMH5۳tJdĔ#d]jTj鍺3""JILfcL.p&2]uܷ4 "!mdL$FƱZ/7[>eֈ/kLgvSc/sرuZVɒNަ3p-u, 񹈡{NPCidQyLs %XVmi`el B0u.VS;+k%bAx76ో uJ1}M$uʏ]3\ fB e*.9LS\"Yȝm%3Zh2fŌ&1`HCe1 }1Q6!3 /}*Jk|` ^W-R뻊n d)p/Ä<4 a~ŽK5SǻA`PrY' Oa`F`!J145к__ "(EVlp\ +VQTv%ih?Y L]'ԝ~*hĘD++VXe`fPHz0Q9YcK] \<4G-Hl\.r7JhE.tf.wq54J'. #S(1L"fDk&JLC4@0#r7aF쥺:H+,R\디^h֒ƭV*Qj-ثZ+kF]L-뷾x07M1 Pa],6 w} `T!`0ۺe8@'Skk뤭S̵lnHrߪ :׍}I销 FQ@>ש|0W6xkIj <"KhZ%Od%Byw];*!"F paJ#"Q;x_\d2Q3QʩHIp&d 7A1D޵j*9ZQ.Of9@f-T7>C`.oۧE `"ﭣ Kf!C4"3]k+ю w0!?a}HK dQվ$$'fBI'$H`B|B:$a?U$$7HH^ҩ{SUZo\lͣF M|W-Vm{MVڊjնCVu,=!d.K,Q"-UoVZkMUmmx֪޵4b j5BHH L5Mk߭\Qƍ|>8͆yNT 'BHM$jܛbmlkmm|mQi F#Fֵ[Uk|b&-&Mjޚڍګը#L,b5Z1Fժo+k[kVJԖd4&QAb(S/I۰~ZS[Q^1_\mv-ƍklQE񭵫omcdʐ* ?!$2@׾Zڽm&ŴR֫$ mڵ^(E&̨Ѣ|UjѵrշmfUTVWbmZԶ~jM%DbɼZV0mVӵZ`(& Em-5TkkoVx[m@REWkҭ^5BLHE5ok|V^Vuܶ+ֵG-V 5Efkůk|v-[m|6kډb0d!< HdēΑ--z[_}CjҊ`jLbsFl[{W6mFisdhմԡjʭUUxɪծXbQFLWlR[LɠKZm (Д5W+d-VƹS6diLZJ@4I@BP^FZ܈+ kL@ܡCP!r!$0%X50-ƭIdk\իLD%Z߮mVMdޛV *-Q*6sEAQrzmױb1F$4V55c[])LTQbƢk[־|uFVimmV(ֶi[ZUƱLE@bn^kWFTj5! @V<* #`c+Ԗ5V2VIcX(6-VZFVڥMlT,EE * 1hDj0+2F5cb-$j-Qmi-Ik"Q+"[,k(=ֵkhX4R%m5o׿Wbэ6hW5lh**4TbъաضԖXױj[UF[Uh$ڭzXIؤ̒#jŵͱm#b6эZڌ2ZπZ(PF F[ZU _Ķަ6VddF۵Ķj|Ź@[A!԰!4"h0&4<$*I~ocFZi~˥l _dNj=?!sF֊,vBPzVDADd2uf,`ɐ@!rI Lx0XV-\hZ6-Rbb @*+S?ke12*2 F *1W[Vi-e"h*2][|oX$Z5H`6K@4j(ڷL!h) 'P " $Fտ%U{鰚mmؓZ*QQEwKb*xj0ڋcj=m? $;d!d! _6̨X%]KcLFr 毧ZFfŴREU{XČ }If4 ,"U+жcoL[m}x[oM^ۚj,*1IE{I$w/7 oi 6HnKڍ}b̍\)$˜t oRtK&d0 BLHI{x- }oO[2fO:[qȠp[C;dZD ݗUfv+- %1r&܁ά"u*RآtjOnc,HDPR?_?n3~bz^yWV~}EJ!G>]Hup_I{@Oow۷? rgzL)'ؒW1  aV%-!axstKYDDV+3<|+rx.R}XX ?V]Ut{颔xS8v16]5`&mR+tАD$"#E%冀"āi Xk~&̈ϖB޼* Q E=MmVye@? mgO}MNWUXYhYhH"fof }ФcX_Pf( i&9aDQNel6o ,$4Y P֔tΞn51a+<["qڳAΘH K>\Έ[`E^K ޯ%gIr6^tuz|a#k"ǀXbj=Xp3IĖ7h}^ ՙRZQ{lxޟ%M :O?}SMQ!p` M+QTB=,;OB4ySecY_śAIA..!bF݁.¥-z[x6SjN牏޷q{ʐaLת"q?sK׉|^~ }oM>1J۸Z zʛY\9hcœ_~ꦕ6jc9:Ɂ8" lR%IqD_94tYh(X)4T̟iۘj\3}؊UIWo^{xػT4q?#l, Bz{ihviٵXPyL|VTf6 )Pkۜgce}7Usz!="`WDOJDF.Oso>5q5l{0 u6SJu#jdۗ7ˁ~j:2A /uar|fv؜LJ` Z Sa fF'y㠠jC?z̏=p6trJx0`*Ui R~? 3xjWQ~0(f*q3 ET qCn!adxG‐pGIlռ4żL&qͮ$T>!2~M#tm!ԙ*eBpD[p"r rt4.ݮRɉ?Rs.dAW贺.%2]tc# iwP>nO`Y9gwKHh3vEI.uBsl-xc)Nyƽk2o/g:`у4e0#.1 _ /+r҃ʭܢjçYaD`AN.νAo@fE5BLӮdʠv|oqM-DxRB`*u_^T#>>(nH;o,Iv Ǩ)/=ysx^;toMh_8Ԕ !p0\v2119-@St[?xpwyg1Nmp!I_ dAg$$JNZX:yI6I,N̗x: -c8=׺WB]Kjb΢Vbr]\NeqDEI?)/сgmvݣ>lWSVbBAY ]7Ydi~Sj}2Kf" $j(T&2jz|#ݽx,K[@ 3E#f[UeѓG}sxu:o)MJςX\`J0FCTzfDr/iKnuxguW5oq\ 8%Am?78jc̻3[Bb&GyL_u7bvIU6F &,MwWFƆQXX(L2zm]ѯWf?m!6X&AͷQCoX πd9lebw$Y5V4ۺC`Zl#+(SU]``qs e];TR,$0*N6i#n4c”2(6vmR6fuK(\!g{# !q pac3F_E] ,JaGqgpd4חE zWgߏſ?>m>S?L 34)$&!ynT 5kw1T9kؼEm4gԙ'+Hdv 5F+{&yg, /jA|%?,'-.wIEF; v:8y˪e=%"IJXgFjMr\V?=&ip#KVk`ƅ(u=ti6Fhп2<؃R ,`N}e#_Mob%URsVN؇o6RvH@~ ^pU *s[!-a% i_h(&aXM9 &=k n>-0 y`Lo9w]"< 7Dȅ?Z0S} զa@keY;U :Ya:Om@n9Ah0zd vh^̷h ƅ]] C!,(c !u[$|IV]e/YQ.e|T17meo5v[53ڎҧ^QTRb@9BH¼`NVN2Fz>ǒ±-!B'4lᎬ~yh~ao{S]yFdN{U5qDT i\ܦ7nׯ{˳3-|F>U^Qvt )$Q*MC2 + ;WG OCGEJ8zF/#mWaCm㢼σ GcroiC;%⻲PYR^wA0߇?yEA'%Qg[.zWٷuG]=Dhn2Ggx1LSy=~;ﻮXSkQm,glE"{ܟm)gklbe5jw(E%`ḾΛ#iU׵! lR*%̴Mg iYvkMj **[4GsZvdASwq{x&٬ήj:/gvġ3XbݱQ`(RVBT+NKxHS+ jع֞>ƢQϮx]dhܮ0&+6?qqat{2Ƞ EH"A`pɗ-K ֩E W[nQKocW ЅWb:K43o۔n3yHq3ZxoWo" B rYQC/{i5O}GVIFYS Y|\RN1F{yQW[ԌWd [-c= zbhU52߇U#.q}Peh$Ţ@y&wkZ6)F1-C&`VK͛qwAwgB {]Օwa4JIxjy/_`ePvbb [6Ϲ1z8Ug񺻮 f-=βr/eƒs}dM;uoiQ{=#$v& p~qQ [wm ich|Y1ə}g*iWR1bu2SWw۴ W9iS%9qڷmumrwwzWk"a2(ROp՛GDE֞eZC),@d\ZﳢVBfmU=Ϧ%jW/w};w(rRQl9W,T~w84ܮx#f 75!!< s!Qw@ڶ+HEm\Xw6PKl+8R6q ؿl!@4@,O,Kg q9C5+cC4\U8 ǥ_ IL 'K.*P>5bضk/D:s] \IuX PlRH_aW{)ez"F>%, #]VNhQMՂl--eӗn?soDW@bͤ2EF(L\̧Mb*ncjWGH բj+W5 RՄ 9Y49V7nhQZɮ,: 4c+}uԋk6)[>85ֵJ=`.zvZ8 'joZgo,:7̩CuMT5CLIsk R1dqgήPn5sMεt`ݛ&bTd(4@ \98ij:dDtm@,D *< Zg10 5%p5t'[dmE5RR)*FBL[nyCjʙOô৓(/Z˻;|ͩzg2!m"" $߭>zkSsYrh$ E*仝qpէ@կk7U5a n*9/'R-cOD@fD 8~cqw%|;J[KaeA?ST]8noٷ;Wn [Szԙ#4Of6<0330fm-Pm԰&5D&#D"-r|"QKĶWE!KRP10b5xMU)`Ts&ʜjMnZX QBǡeWk[>&m֪TO. {+g6ތmib6<0uk(H#ɸd3|$ϯc),g-v@lXI$a~+! ?qo$$oࡵCOm 3BeE+ xl,jC2I`C@jP>"HHldv$$ :! 'Aba& u }$&I|zM$> n'r$IޫiLxgfdhx̓mI&$!{$IG UHLԁט coct[^Sjs@ډQr7ǀе)5}8B[k֢aJN%b!x *jn^C֬˹Mh]Vp-}KwI`}| /Ct@`0(]|ۋ~%cFiQA@@*d? &+$Mɂ`nZh],(_thm^14Q G-0sB%$7k:u:=z>ov?Fz"L]PS)Bd89HO|}_Ӂf$1׃CKyoAKi~F]ݯh?@mIYdD5_=#豄~~YPg֝u?r?KēR*?eaIK߱'^O.d^I xO~_Ϻ@#yBW۷ ɑNi4Oa\Ȇ؃39"DdB#A"`̈eĒ\=D@?ƾH\H?'f<(S@L0w@vc\ J@! A;33_Oz _qpoWd;Z?0H!_U/r~J_X )l?3CFt2ya6[M_8o 5UX/e{ |􋈇Wl0}ˑ&أAA^J X6dovB!F.k3XVwU&tJ/g@C۩v]v>r=@#A T2$!:$ 3$oO20 zV@$!@0꾕zR@B|$$F_i dBBd/Y}v}&rMVB zT }3S'_{M._sHO5@@dwdsٮÔU>Soy>:cLJq^<|\Yi#ۋI?O|x0عP)Og'63gD4߈~:D @h5ۙz/O΢ re(] ڮ*#]Ӵgi ocݗs`Ϳ^x_FXW{ =w͒W͝u0ѡ LTlVkHZ8@'ʲ|LROJo1@T+`Q=_~1;[S= 򓙅"(I{) Fu Ӫdd6HHxlOPVHj0{u=zm:?j0`>HyC"{uct(ԪT~o%}>YŃrqBio&&xf =G} AvdQXFޢNX^~H/F*F~PU$bPVT{jjk4-?OFRV=7SY a/lAQc%*K5x{W{!4>aq$L! SC&sb0M`^}'f/v %DsPo, \+L {/ZJ=ג4>4)q:gk.c.RԥdɪYqV BWܗdueQflaI 4Bcy}@P&G΄,Q̴d@n6K\ "\_1{^V-rR5e`ۚӺulZJe,Ē !3bnt/d,9X;v+e4ӁѕpkF_ 8)CzPkgrLW޳e\t{sOE7IeGe\˻ƴ|KЊyq] 幯Vy2쭬 @vJ4!@f'nW*q6OAB9Rmvd6;=_++m 0$?%A`bBw O?w?nmI$Ot,p gfsHOtoI;gX=`K$Ju66uu6Agkhɉ 7 @ ߡf|!"j;=ANsǡp0$Ba =oUVP 4` NͭVp+8b w56h?m{i ]~sfAzZA#xgE>eI '?%.[HH4Ft:-*Bg争Kwe$ ZC,cR9ڛJ?ӳRxaՉ},__p woHOcun'rʲE| Qqqo*,MՂS[Cwk_㤓5mF2Rnw:,glz(GE*$~|O;r gq4l:b~}n820ʒ] 23IFj4)r7mY$"`a@p_z+ғ=e=` 9beXEVcJڴK,ҙ"&d!u~ Jg:q4-4tY=uXcXXf*=mgFa_˚n[RCII5j\ِvAOߡ_+ 7[w;I$ٰ6|:0b{ h|$2粥j~LnWm6FyFa F3rCܱ%7˂ӬQva&0Έ0feRGf$0]g.`4i@<1i@(m ԕݝSa8@oEeZP h_YF|C$ L~CA@JPF^v٣N L<5!(^R< 4}隩uDb-XY.<~ڵk.Xc^Bu8(EXL _Wm=o ^&)jwq?ii;S*iΔ;I4ϥs1fOFGs9[=>Uqb4piȪ);&X a*Z?YD=@8!Iu[Z?/'?GB ٽM 6|Ze""&A ė-VFC CA }y@/ !B NhH62]:!ȳB)@c6@D,BWz]hTD hBOfd9ij֦Պc^B)$Q@]V5I[PZ7zwfiŊHVjUZA,iDt֝X&46JV=A(eK]1t T̖PTBn !9Z}> ;O$5vg!_2BC !^':.|/$ CH۠B k`#QJft]QAxHk=\!^Lټ3eS6?>ԡP3~Oљ\HH!2rBD:}@ $$bTJ@ u1|BI=!?fMpx !>~rfdHRH)$:l /[ =3 fr3K$ҁ:y)cZ8Nd#B',t/(8qL4TNFA5ЄBN @&`DC dfw`':d #mv7fqHBz@ a!!$!HA@!ݍRqs!ljVI'w!|;-HC?*E?? /N@/K-jݼiCQH`dDEl` @c+aNrI>:$BĿ]Cܳ2Ozuݡ&ɒX?@6=>9 gr~cI SkP$2T BNr6H4/NFB@:$&M &B@Y$@]$$, ;~S`}@(T"yYS\U@0O\w?:C2cȵQ,?RrYWr-͘!Ξk=C$'$TPϲ@!dC"@kA{8}pj!aCx8 n-_I ?`O-2mH/]"LRsqy"ez;}7:Cpu~]|K>1_;< !vߣӤ'[Qݘ&S WkȳM,kgF5XltQ‚Q'ʝbnu ,5Q8jf*HPƪ}s3ឲM_5_4o+5`QA XIF&9tʛG mm' b[3 0&hHE]țkYu°Z*OM?qŢ)*0&1E'NIVU# R)::S#~/A*"JNU VH'e #Z-w5067J@ò ;#< bj ye"Hi-]K_8e0oM~N#yLRŎhildZ]};W1εb| <Φ^qVUqѥX- aHlQF\c(\D"!Xv]ϪXWOdr;+2Qޜni&KV{F:a~Q$|ךN3ͭgV94O[· r'Tc#<.c:dEq:!9;8 q-;P2^ -: +Q.-v'l4?skw؅ڄJրju" wO?nDԤQG+=;tnVy?f*fnEJ1g!$o,;˔%m{M3.##Mi>Z_Ov"Խ[4*뮪@`B#3oEQ]ݏ]:R-K;czH@V/FQ"P3i= 1 VhH ߋEf9ڦL~ͻvYmD|6PI&-_`3U OƿyB'{vB?ZH@PДy$qw`߸7;hˣHu0 6Nɯ8B܃[&!1$ͤoo`_OpllBjIN=u6:\6 OҺ~s.njتz5O,_3Vh^S@C!+|*tr}6z$W,.j!Kcz"S8ykxK5>P36P4\ke;9F7KQ*jJEV$n7s۰.2ށYu:G `\^|<{%6|FWz<&];R؜(␀q7>#Be|i:qRAPMP4)oӈv!Àixm٧6U3&0t2@{V@L3G=<=ɟFmX'~N{4xG@kˋG[iK \Y !}aaG.!"I_ >zP VoR݀&Ev;8 kV!nd28Y`<\쵚qo6ao-:wK&@3'2+QD&was[;^NL˜N}vBR9Xk)#d, 38>فa$R ifb@/Hd%$HuoX!>U\{ zM,$?ϟ@{LQs[{,l\ [I+I_ D1X ,c-S>aګ5i +eq2uV8%!@y0*dijFL 9/RH[Y ڂ*Hn)JU*0 ~,1֍Ifg:&AE4sQmIk0[PEKabɰ UQJKR>`fG-Di,6FjүmNM]G.dՓ\!\Ĝmk9ޮ.-|f d:ab?e!uv? 5aapl$I A'ղyloߩr~g?]ːt,c|*sj?TE]LFaxο5-c$`^U']ӝ2nS+XEA~[ǗJf.2EPmT_ǠHI \@}@ C0 m:F!ek0aE)D-{&?lp?n}*O=B1)%FJ QW|~ ibq 6 u=L"p\MgHwj!X"͘"a`$3?qtO{jmBhC MC? Z`U#o8[[ô]PY q7\у|, =@ CܦCo0ȝ\ԏ7D}ZQɠ{֢3:ƠE($,y: 4DI9i]Lά8Ci/yҳ4j9ZJMk̮E-wv I:*5>Ax>쾌AM̪ d5CIS̭WmHdkNQ=@OI'7CEs|lQb\"?5PaǛKDwrJe) FHDwgK5۲bYĵso1#1鮹3d]OQ‚_[S {2Y?6\UV3k̈{]p93 Y=^z4-⣋37fF ~Kjlk $\@͛JbRWNX21uTbwyDsa?0/Cez?k&O3K28~~.8 2WF*EFT uEi]0jg^ToT{fZם୶?;lu&%3.G ((s"bOxk?!~gJ2?_>_r|ˮ=x.gSd-a0< (?A}%ɝ{YR"߇z|wB2˯_lgŕ!;$<=osP=3h5P6 Һ:}U}_/! L$d'7~O߆'ga ˜ˮ wzSj%G\%P/]Bd,q3 .B@INDYS Dx35Bl9.R>_^au?+01:.awR^ /y+#eKz󖃿,+)OYD DA"%EJAGK%j-SO =$m[ gExmi?F=v홻UC Kg i>>z8O%.&?@ ]|̀FM>KSu*}!rq[VC<ǷKr*8gd$d!0BOa Ρ>$:C$=@C u$Y=>=F}o.]kTZl3|[>Y~ ͈͙F3uPl R9o4dBRh ҝ_k\% > nP2_nU.foPmb82_oFMCgr#$=x섞!<,tBO!'`@?};vBCﾯlnlߤW+ ] 5fx&2yK #0Y)"AC?xY{}KHt>lj尼"!HxL%YSx7eQ1yÕPƿBkX L2lsY*\ /v&@>@eWυFpClP5#5'r/&L.J.^ Q FaD$ P,S Ԑ>K{!{D.uZ?P\cZŒ,(Js!d$HO M|,{\>P=^K;ӯeT¸] XCrIoi;,DHyx ^vnᕂ#fw(` ?=TRؿZB}kQ>/nwc-}Y}@ۤ΃4K2~2I?|d$;I0&D I=ic,f@ֶYG8K\\\ ŀw ̗Pt^ dP V 'bs==Oia,Z*UlUV*s>wyBN[89! !# $ O_47x_$8qm?jrnpݒ^N~%@%R99TOHAp@H *Bw30"0)w X -Ȳ6 ^گ* ZTwC%Zq2 S48ԲkX2E~Y"*$d)HCt߾.*k钭wїBhW\3 HII'0Hޤ'Iްް!sQ w@z4NGPK=5//=2JN$Kgd`|gzdrt.[C q7(494&{@ E?&[~$le"2P\ Nfq&綸 { :,~Ӑ3:u|]ɌGbQmVv׺cjL,% kcd\MSr :}ʬܕ`8]|Iw!QD2H2|,Ű8 2g\a'kb52D/c:V侫fCg۬S^?ziTRK Oz p`&> ]zmǔSRA*4NR]#Os}'4!e<%aYQ*΢Je̋Ģhc3bri ݋Z:G}#ed>ɩ # N;bUfv*e#*g @ѐ5XӦDE aթл93txG?+f(2\>qfi@>\;qL=TBEH2)1 1I @"\j\vq`^2B\gc8 98sPf:Ą]_Z# v d7Q3wV!=4 $6Wŀ>܀j]hC\)O"fo@ 0, ӵS Z ƞOvYu1¬ 9+"F3!cx=Juv>!A@`2P?X&c[l}Ъ{NG qrٷ6w59/k\Pj.SXUHY8?i39&muHmd%gu}(~o$N(Bd2@PYSQM$5 נs̟/AbCۄ$coe{Sx<WM]ܕ˥f M&=>wsm_ad´cg0J"t*O2Bd튄 ?_ԔGfQֲOHA$zaA *_]`PrK@g+q_P;{pm$|'hCl&bLFJzԘF2h d>uL(t l jj'yXP3Uas>gЮd/0I~v4VeVe9De k'YKg3f,ɤD 1,D%io t2?-ٴdK_6P٥3fVIIzܤvh%ٮ*Sfo8RւϨN$bXDX%K}+;82\]#U dRzޜ\&S]8Ud7@;{^{X9?*2?!&GkPV~CӰ2duΰNɣm/êbdiIcDY_vi{HwFBat Va""DdI2 $80]ډZ%m $c`CEgMg+;z!)a'Q!%%I$.ԇf'Fn53 HmiowPn@ )ppţ~4`޷,g.vC%̻U'&lIʨšvkum` ǥN]+Ch`#y僋زMR@ŀх1~ (d}MMՀ ˮ!e͹;g|M{ϚglKo#_u(0EQ, 4_IHۍ؜N-e*cEqgi,  eYjK ,bݮyyeM4!d솅@"I):BVgxHi$ ,+R5ԸPjVCF Chj[; kf}"fs%6}Qp5@lQ!Mm϶Ta UleRT 4r0ӧ֦:jliF"!S,h A@SPņ;pL6[2cD䢍6ile-Csk0& )g\Ob9O؎0dbsC2Rgw~! {l2LG{*4)k$XYW>Ax]u'-ŽnϋA+`% 7VN>%ƹ{ ͮanĀL6p qʻ|q#u$8-; 6 "bg,r{bW=vd9]j,KO47$X" !Rq%B4#÷PT, 9cXYPVj]\67Sp'`JÕ}( Ǒw:>Q12/c`#ړyau~V90l@Fg(v\Qd70/b%0O7W`F[(ET痊U׼צkB?v/ ՓB ɖrn0qJt{|a`H\=D|^; jCRdDL{'ozvˆ1 { -V07}K@"+qaʹ>lh!}2@`oB> Uܞ}A۹-)ᄀ!XwD-`X gT/ d7|c9,$&pg???=U@eܘ0k :)UR3;!P[}iR(@fS<3[4> &.50c`j26Z$Cev=\!hQ$Y̎Y,C=Valp%k Tp`Ea3iba@>` , N]u^ PBqF%Ph@H;\ VxB`\@@Z_\%h1)Cz6 )3P 41_}Slsb,K.  a̖LIrB7.dTKؗPVS$XkW2$bf&@Ι sDr,L%RCB\ʪc#%ȅF\ndrT(dHEHUQ K$i4KTXJ * RĆġ*} T0b8ڵ6`JYB:b(@d: "'c_^BMtŝPiȳ)!/ch. Kg^6:lU{$SfиQ+^7J$za>÷~$1ILţfw{}/W<'P^ D]ؗ*f^e.WLD+د`ԓdvB6*N!b^7L&"v~ߡiu6/`mOY'{ꇍTTl6.O$Ŵ n0w905*YHU:B#g wv+ 1T{WjEoA 0g0't*@+&s)<ŧEwqF4| ɦ z@xPB}{**X 'DrqIaZ?k~ߑXfTոkjZX$T"u [ 3^JP>g$k@Om;}$簄*;$xQgŷ:ܫ.d+fɸ[MϗD;pqyy;.i Jd7|6DR8cK7{3 aBDNEcgM[x070ǿۖ=wDEĨT\ LխZ2 l;GO%zϐ]ǞfRf.PR'jFdPR[Ŗ{ R,jO!VGOE6B#>S*@]=D)V, aV?bҖxc <`0A2'H+W{+STuD\)pJ,ᦓ;z. تP>0EQpCX5r|ȏ[O@'}Y|.gx t9}"pc3$ B1\P9s<˼vKtG)LNU`V]{)fܝmnRDK͘199[iZҨA &!Ve#ˏjW_T)Ec2 ^KJuȔoOU\SnR5R`٩L,I \WKT*&wXɊ2KAQQM%$Vo oWȪay ZQ0o0d a*CXz4*!iSakk_>x?, hq99'AA{2@nB_P`<5 S\ 2vR~9#vQ_a~߷y&Iql|76-fڗ^![?$Er!OPDF Hqw;;q%ĈI  l꫽顚[u:;P lǒ/a\sU+Qe8P%CqE{I!YNb"4}-qKGT(n446p2=2 nR=J~ [o{U*8 o-;n8[Z40A@ <,wX1eôoN'^aݎ=Þrxnk3.؝R s*,֩Bd1-G-N2' 2塩uAU1Xou[m!x u,HU6caE.RAl#!=t.svѺ~{v#(0=;l>\T8OXi:# ]X>7zl:YT**RAR:72gĻ| &Ik\Q-OF;B+cK9*HiP${oM,y|k,&Kr7! +PEnpphEW ^Q ۴ꬳtu8$6)SϬsaE( YB u "9G ؋Y=|O5OMWv|HP1qуȆCB%5~O޴@&Dj\e4!Q :0]?֫uqje@!춗C^̐ $ᐐt*̙5RaQ!ͨ64;h!ن7˰ݴ7?5Xޭ5nH3_5gl/Ds/pF0ۥ^ ɚ^׾c.g g=y@S(K vq >Ԛ=TBFNC(dJ:[R²NRkYY֦zw)SpkeC S[B4Ti$%twGnuruX{ K UM 9?S^ҹ"Y]SK@MtlJ$ 5 M3]ލk}d5sCH9JTO^Hdw}[m?߇ƈݤ75lmDK eR5oQ鰤Xd1@;AFr_IFo9!lWXD>9b H|R-UaߦVq$_Zr3U@XB i/ڟ*)1L@ujrda?©9~BI2_f6CW==?E9`?}!lGW)IRHI C 8"woW}f`mǢt6 'E{/q!2$'! C*6&BHcIuDC;Vn@<[Q?ɄJ ;%~3d:9_oc'Br~zf{lݿi66yϗuן 7q9̝{ ̯CD"~S&r@Ȓ|T<ɑ2"Y`6Ҙӱkv?F GE:s 㣫In"ԋ>Liҭ0ڬzӆ!޲WCT6RĻ숿;paq/WQ{JpH9h$V5m@YD#2̮0I (R@ f^:%EiV*@!љeT"G6l ⛦ l&}.yx%PէH}oD򗨜Ѕ;Y FE^`{7W,Sg [UǴH#,`}FvPJyH~!m`?P?=-|d0|<z_q+_6}‡꽥/zf xu(z^.K%4^z4Zjs Л6@>ޤO$t5!3jNJE=BX0V,]M&0em @ 7O$?y>}-V3b!٦=Λcq/}_x_{@`з2V`OU'Ũ2S_]XL rc[ ޹Yi-f@i}. ^RRA g.v Qa & C|e03D]C.i_6жS/%('PL  N/=Խ6faĭ?[2X\p(َȖ1^l%k}Jȟ}@A2D0=q$| ((H&3^ߙG룲?ӭs-~8gȬE ɶ1 |>KؠG ĺh$gj [ۏ?}K)fю[*Lzp8< ܰM[fVG-Puo@騏c,(Xi(FG9 Ar )!m x5yᨊ ag v~luB1?0[ni*'T? 2Բ>#OPSF7f  Az)J- Єv[J4f;QLyD Pғ6D_SG?׺[W԰  (^Eԛ"*K"Ct'uHC)FHdY qlN{IfD}߭F+۟uCzSck//ʭ9Vg%mNF-[9>Z}F-Bf~c5m={ 0̌}lP22\PM7 oG<]GB9x9$l\(-p$5ۖ,LPJ`׆ 1L_&jo[xASvl x?}9l2:ޯz}Y#jԨ<"/Ahgt;3g#dp\?ɑ?Xz1F7XougoTLI ϼCOVON}(=6Ϫ |s̉6Ƈq~d9:OE}ҳOODkgGFV~zvT7؄ a }PT=e@^~@+Qd %͒!H˹w߶4;x[=ȳĢS~Wum+A|8`KLWdC|v"_냋W] U87v^CeRR?߭f:s"Ub .ۿsK| -bkh3{;׉BfY9eL$F6GGLLZ5GHLf@ CCܱj܃fuֿg8q5cj_c ȥU?XmQܙ_IflJPnY-u ;31*W.íQ @#hKZ]iYdH,ڹ w 6u|޸3[QnXyd?ϣ_=; h]%Rdw`bnn_ I,K "і;{nx׼:O6ytvX!l-](+Tb Y3X|qNbRYT=~-Kaܞfjʋ؈߳:M~(az<P$2c؎ϲap,.;ﳹ]`nf.; .Co-2-b3mҜf9lk:ho |2!v(l3WLo O l$rq䳳-~LGW͏?78:7H,1*dWxA4=2_͆@ 딋ixS0`:ʀlEgjgS䷧MD_0/FcU6-xq kr&(lW%!A{c(\d<̰gJp | o B1yoi 6@b`Idvq@rU (ކ2Bz7nSҥ iqbUrfg=cjuWʂ^?c/-3hffCȜ n,rhjCݯ|| uiGN#דu.K'}"ADŽt\z'q0+ɿ;/k$

X0 ! ʳ(k% !N 0TŹf1^ (0ٿD!A"L( 0d {VMBB.hf&WDs1Ԁ (Ъ)B2ڿpHmfn\m, ƯH ?Hac$m{E`_*:]P'$_d=cPݰ]t/Igmbqt@- r=zfX 욢/¯ f_}Y`vפHx0 !5 ?>Yv6@7%8.`P YI1,toM%B9YqR=Tw@5yW[:C^F3RNEFT-2w8 22\( f^a,%yd5Z^¸ŷ'o,9`$`ϛèp`Yͳs$JTSs+r#~m'.8߸" av2`aUl!R+[<kr[/>D[rfyR~7zoKs-kZ$5}O{㧿 l'.hu[KwÖջaD ykUR_cբ6э,!bx #%Cub*~^m P%`1Ӯ[-UA&uZ,~垬^vn-.}dUUZؓ@}Z#awL'0ǏlrTLgW0pw~,/S""dcbW2_/FѤ:Yj:/ćF%$,ߥ8 ^i<]xxG 9viwěNuzt>z{FM@EBB-A !D2Wsu(sݺb2C?/JfoDm#E*.EjX` 1@.=)saƲ3x/Pea}r[||xWqO0EH"\`j!pA^ 0B:ёUTu#Z#TJZD^!Z$>#ݤwR?@?jT_eƭ? ~߿𮛄oy!&?}δ%$cd࡬u%C y5Z5s Vge] mHxB}z&2?{NqabCĒ"!, %dI%F=YճjXΐKV>xڃD-L6;B tf:/I}_ͣ>ýds~?T'ǻ=:6ݞ#|ϑ2g4 @Z$}u*?qmW<ipҢ,jvZ.1 x#VΙ'ߖ`Yv? L4u\œ?Ɛ>Je2LFpȤn])?/װ[IMnd7Q7 ҍfA ϡ>7r?b+T޲"L_WO^(#irHQn 3߇\Uk=Zg"zB߻`=5DҶ}KιuHXj44jneoYuDF<[bՕV,N@́Ѷ&h dD(V*K_La[|G={H5&LB_Ơ+ aC Y@ח)ž |ϳ~lRH=l2圓QS5dv89# *L Y Khr[fjDS4*4xגiO@LSlc$u3lR^C]YΑ٬lRsw|w?#e Կ y"HVU 489vV/(qgTǻȗN9pӋ@_,|hy?  }3g<Hw/H2M<6N9l2Hm`nHV˷ q|{M;KZe.ci#kInoIj ;[4U.Qccj?SB nd2o?5EC^T S|{^W<;BWB]_7YdW>qMhw譆ҙpw}Bz/^M[|\Y*UG BG0-){3$NKa"4]rkҗTE8$kR/gl.9Q@^N""c4pVAL$t'9 9,< N'ߥr"'/ pEre_Q\|b t o muq8 ʁN(>^vdh՘̋0Yfy[A:{ebs_(83 v !ӭaܤY'NM dя8HKƷ_xi/LUda1D / xܠ:r)bu(1Bmiq~`;Dtp5 5H\&%jO!Ҝ 7r*Z} ~'eн7l'}%tXtC< Sbs5\O_<4>dU L2m3srIE7me>y1u/ϗxf㜎v`)M-WI\"bs--ٵe+u\̗V<$k̎#~EM3bCDYK ,;kukαecoI(A$m,TIRqcӬ޽T`[mR2IZ m!;G#%cr=u~"1.ij 1 L12& %/k ^\nڜ&ԫ\ʯdսmqn/KO66lm!;Pb%$h}v;x7Fä _,s/f |Ry k!qD `E :PtYZrHWhj}h@Ylu'$VyY)f."r}"FErFș%f@xI?3q.6;5蜀nƎU賖@cv"vwl 3#a'UuZv IBb]/}5!0 ?J Xf ÷U?1[+Mc|k!Vt= ]qڟw@CIL^fܼ/XrC(}OӗGdxE2!O`&>f5w?z;\&Jw})XN+8oX:DDALcGUupOpwHks<~YmOEɭ_gӅ6oFYgi!3p*} |qз9/O!vu4KBp NGiWFkF%msȽkA}B3'z}=),?yQ3Y Qe s&Z vg2SsϚ0' pL3gKGq&U@d 0`r1s̱{OB&ij ~6Q_Ydfk!j47e_i~a;Wv*r'cݢ6} y{GT/|Ysڸ4T*#@,ᏣKm=L!22:MPQ?kѤ T=G_q.*>?b{24&ⲱ微m}JudZ2~Q#\,7П* 17ʙ3J*@_\ (D6h.hp["w]{'oL{~ _,B d59f`H` svlc+VZFPE{9lOdcㅹ!ʲvc2׹jAC2 a ҩSM$WFR `ta?jf-;KqC2W.DzZNēՑK3U!eסd~&Dr|Vhr,Ts,?IE:9yQA5z~ çbti'F@/ֹ@ <ܾpny(П /f ܦ2'z *(p]9ʯ):Ga.2~7W%H<'i0setP:ZۻӋ5_6'ɐ`Sh %=*j#3gB =q eV -*$5(s0HKtڦE#Zmy UW,@#FNRRM2 QQEfJF֥pNo`Ul6sfݶ% fx&Qq4e\srr4W}$g+_jUfJrRx~,kiۢ{ bqUGI9|~J ? $"7"̽Vѐ|rcćaTE{|9@K4u/V" ˔!3=+ghQ?e#AN%h#.?k4(`%={Sh*o1G>G_'2jR YHS#fii jPY6Vgt0\_6g3HIڜ#09~y>|.ɶ;IeS5~ M¦Jj|2fj"' w^d!%aBTt/n4c]c[><# /|X@Ag"2fx,!09nb;.Pb.b * ~#0<̴[.Y!'d%7^}SZwL"{:1,0?2ݫV $_W4#㸐>؋kAYɲVb4Zw*h {Cr^]B|S"~;@JMJ3.h`\cުX5Z@-'0km,N@H]{Pp< BAؠx?şث@9DOڙ S /!Φ4?>0Oi1FBww:y\(7FE{!(h|SV#Ҹ*DŤ1ceִX oSҲXx,إ#K(?+I~IqbhHZQS>Zʿ\n[@V >wz^C>GlsdNnZiZ|m=cĈFFk$"u(O1 Hfp7_>m#(\?iNoZGALƟOA9]{^˖4G='׉j<ڑjt;<ŻCjBf;ZaOGav&M,bT:{Pba$.oK) Mυ5}i6y++:`u8m]wԟ95_֎=* FkڌҋH-yJ ]>'П!eO,_ưWia5aq@ڻә|c"yʆ][4=@FR*ֺ22d/SϦs'XT?íH.\CMaj&)UW|ֳcBM 2 ~kA_1Xd2ƱœOi{.0y6ɗ|֧ϛx)L;Rox~A7ޡPk f"B"x&Ӊ?#0ZwZe ĩe1L,āwyU)2h{}]}y灃}iu[u7be ]>/S4't$v:@!dlS\w:I3mR:˩{&Lw^' 9Z/nmT8\fs@3G X=̥GAOw;{fh'Li4v\j$aa3H1c4vK3>g`}'nj'W+R꟤yf :wsKGfÅչ9gn :G"ԯ*II$xdUp+L L^XoA!! jOҲgVk?ul'8zۙu @x&LYt}oެ]vSfjWR<_=cbo2=*h9?kj_vܞtl8a6+P v_'"?RkײB/qg˾O-Uڦ`t4IB ep@3Y *\E :~=C陝Vm_ g3uRGb}܈9=;Gc.qDE7յ`%a#n껞<`4﷯4ͷ3FCx1Vpz q9ܜ:E< `?g[@Ӣno%I`1t ( [.|lҽ޶]ֆ ) /^)q84G~Nj3**yR }G!}[gq X@w g,kEkp_5㗛w~=w56|x1c&_>miTZ:Id,cѭYwh |UmҲL% ~L56^:._B{F.[V_=QoqpɤχӃ[?֊oٿ&X:tyJK/`F,!3aT;(vA6,.ID=lx@VqS& &C9H1d:]U~]e7}knJV>p:ii$rBҦeSXyYɮN:.FԄ^B%jwiA" ۹;?Eod=~djS2VZgʛ膔Ut ;a'P5ݯw>lWt ~##D7}+%nauj~YT.b ?ɞRR%2RIN$ 0߲_Ir\ ' 0ؠ!> }6ڏ@3]cBNْHoHzCuP%=T@JS;Y^ǽˣ!_}ycM\0ik~RЦk.{rTG܃cwDPeGR-热C>dxK{"nd."ۙy}R@Yn2EeM8SZCD@\Y$(L6˅Fd8T2d\f9ϾebΉ6!2C aXOBЏ8oPU'ֱA džmÍ;,0X0 5S+x@{>GuPΥd(~~OWk]Tz;[C"f'›X!ӏEZNcc]6&.>J(c}$:v54Z.\G^C$̟ב``iu*;nBaf( s镄MڂG 5}{5sDɂ3VL.5K #a.:,ͶPڧ[QOxۜ3Fߵ| G*m϶GpGS}2ИQ ONOv+8ck[cjm BKͪvzd{uυ2yB oRȞ (DV%ưNaTG1;Q0CPGwȟ8Pقښ֪/h1?>~0p6Qa$`Kg+)1*HyT@]6ѓ>εi8#o> 1ͶSw\Fw'KmAp>8_FUrm=M(E/K+/F0qb G4d!"&z"s}V*vyMijVok8/uc7گ&&UIbO(tToukИl FNZTI%$@b@P y- i@ `B Aaޯ_[0Xl9ҪŨܷ>ʵ<] ErLFu5_~\c2nlvBɘk֤mMՓPC RE({ᡗ}^^n )rtܪpHwo9/y:qN;OJ3y6*[D`p;D΋̨Og h^點1wOV#*\NKsh7cBn2}4^ycPq_a),/H<oAY@gls<ݯf3$)IM ׆kٓ\rͦO \Vo~ V6~.Oxw;͉kIg+4HBOq,@(T2]$sP0T/y5k9a1}Ф,<ϚR!=z4dd $5K풖)1;Wk[ֽ/ |e.-%;uiR'Fߞ>;+}OMJdM\)֙RzJQ˻UVKJmu?H3%؉[\R|-Z7GoTI3+DWp5{alL{c\ :Y53Ŷ[2D,X5.ұ}DĈ.QCH  ;t$gDg4b( a+xIY޾\Em{[OeICsD( M;Y/D2f  ,|A\*Y,A5 ,ᔘ!} Ex^8G^%ȶ|! [pRz0HN$}|tSwC[M{,+eLkK6?fh#K͓Ux3J cEdyrf4R@0kN7-?PiĆēFcϘd$@zנح]Q*Jc9r#9B9 N왿8ޖ^ܞB;ĵ)mV`ß5N)j Wt xkP/NJ<32oV €91~ֽ5VhKN]vݳ1dF,+=bĊC>\BT k)}&A27g-JegGcOQL@ŔyO+rSj갨{yqꮼљBJ P2"9эEe ]U"I(c7לf_ v( ;E+%1]\JП`PCk2T ZWX@~`@bhr-Eiղjk{ژދSHZƄ9r=fu8Ϸs__* ᤎ>IN M^J|%* _ˡD1Jv8 PIdŏwk"FJ)ši*nrZ=JRW_V/~-P1WVTԚRAtNGn! $rZ ymH`f CU_lk`Qi;yz`7;&#`iGfOZWy7$cHz@H].3m^^ |Q.ZHlԑr2dAe׷fD71i,c5e%=  pUi4wi|eDu֐&d`"&S6?R҂@CApX1a5M;FtAʶ- iz]qx[Ò綽uR; ,vΦ.KVoR}yd@2ٽ\y) Z2"u蓃ܬ0cEJҹB{8yZ@K.: q{[59l A!sj;[uwL,ؔvŞniWpY)(ތ]5+7 (`yyS[W;|D5`Y: 6:D/ R65 ӊi>[_rM4 M-JE@-n';#GNG:MX)1K6ZO)iHh- !uGa &R|-:{ nW\Qdph!'AY+neI,k+ʕ{RJ}2 ԍ5!H2[~"͠ZVsJI GE-kӺUvMF%|Zi#U&zd]8OlRp8%nKݽsa0"\=#KYfUsIJ+d_cvuw҅[Ehq j'9 fy-`XbjY(76(X4-5j]2vr>gAuLf&ZOu* .-yXg(5i8hԚtTVgp1TSԴ/EOV%lupTdT"lxVXlie!B^F\Kj^h/Y~z5/"%)F/=y(qknRp.@ "Re!zCTIC 8q;‰W֑E*#N= F܌6R6CD!Qe'1arT*)빯A4(vӫo`Ud95agwֿM0VUbgU2zTːtnO#Ҭ"xzdmth˨iԥ(ُJJ+d2q;O8=FyLFx?+MzoZOYv=c.L4҇)R - 㔵oC~4ݥoan@(.jLtZ8-TuV Y"םӱ vSS:E؟e" hbn/'s1 ET" I1H͒RIE=K¸*@Oya g! J b?Pk]o˝!R&sm$èm$$ܙy6W'DĆ $R]ލ{Uϳ/1ٍOGW eivyvSf6E"CA[W5p}-8-Պmg/ 8Ŗ0 tB8^'1q>Eo><4P{E埣qdܟS_d=#=z346EOaB{>gK4S:`aJP><E9JCgJ`%{U?yq8s=E5?EO2{agrc8c=4N!{oT?S5|ycRyݯlpOΒ|BpdZU1>}R3-ŵ 7w3Y}DwD|ip} ӣ5a(a7V Y^i".oSyFLӒ#^Bfoh.vv:Z X8x Ϥ% :nẢz^EnfJGKY>evjkEAt\[TVh$T{~owenwS&ƨژxUHY8(?k! F|Kxew`t b-3jB4]~BM RS3tA(S(#u* GcXf2($=3+WDeft,68`H~KZ]0~40[r~@JSR.[[ѢcD5Z̽3A^TAMȸWݡjK_6)Ru]n ^<CuLRψFD3B^GN) ѽ[Ah2[lu{yqc4c=FiJٲ@H[~7;JX=4.eIZDO$Ì), R<7)C rk,Hl{4DV/@on-t{\a*{|@p@(Z Gzmk:Ӫ\i}lggj$fd#?gt,Omg7H9e+eꖖogBowH0vRIxf@O&24rG{9/<ΞGt3b}Dw+{`Bq YAЉcЄS@l}%չj+~*\z.""Vwp: %<՟5'B{p~DƫܘvW%B64.0ur0I [Z}§/k,ĈGwR ,]p{X*͍O0t^M$Y?r@aI!)'2BErJ|@o7UO~0%ēs}CY Mn? _BHI wM i'Pa9d`{Lvc $!>5qI= $ !!&V$蕍V[m{UԇYWf*MN!]$ h_aqS{8TLs!v_9^YStQEI]˿ F/!@ !oߥAAIyP^Bt;ʫ2Mu"a&?jВʿ.H@AAIDreH.5=E6wa:IP"_Ky `OϮ-&h{N]dpV.Xk~~?7 Q?6|޽FNQ-۹3Q* -gjuPLOywIsRvZzc 5ٜ! Mz T/6t|Vb!MLU`k&fY 8Ag]E " ~09|v! T lwe2cw.Xp~#ShW*Ir#k\*kߣHz߼|vo`DrmyA]3PHFܱ'v23^;- ?~UUc*~&\ɉ43̨531p|SI_ܗii{ki)ShN2,~A<QEj> An#la@#J:u>pӛo]O, $1YIJDl`VJ2'>+Z7!9mWߕK[PQe6'c@>Y4)?kYj@`ALqFla0(kEXƒQOUbs=6:x˰0=B(f8iߡCDA Rh9X]_z{ ;gl/$#K5zfϽaH[_0VJFk)Bɖ~CR<А\HI,@a(8R5oו5FĒ/hQ"a-m~kp+ 3\abʴhMμ#FVhLfY[xkQj$B2NG=#z2PT֛NuJF#&' e_wT=[Fzf!+CQQGŻ1T+'ɷ^qm}ż2߭׽/{Vn(+&a- %c}jDwZ6%X0w$&ҏ_!Z ?kn~gkzp=Q ?-hxDCfy9;FV\a8 #QKQ cNu_RFxh N\$F{d 3 kibBQ;TEd4}fd<@o6M\=q\wo&;:?*lJΆ7f Z71ۑuFsD(R7 C*8% Jb*+GcmޮKbK5Yr߸("ށ|n/RozB5yRJn۫/B Gķz$:rtb,sUu\]M奏% ds΢ɠ{tK̉4}wي4- ,o/Z}pHl_~ qXZj$vO-%w0ij Q|_WMX[xӊU|6 Yׇq+]7m7Jx@50 z(PGUa z<>Z][0nSggR%ڹH6퍝TY#|]krG7KǞfm.ZgE{Wˬ3,rg gJI?j2Pc߉M !G $u,όƁ$<^X5nV=va$z|R"7g X0t6yDT%6 ,qj3ÂA*^b{A]' X (g| fW_xn7{G Ġ6 ;5jÛxfMAIn0NbrҔcXH,E+-]~Y[]]{`ȯ~wM7dt{4-_(ic?w"oOb6,v.&1|)cJ"7?2Ν{cq)}Sa`7^TC?MN}pD,k'͜"NrJiU8I@Cμ5 N6xƥԴ?6-?yX4Ӻ|vn~Vp*c6`kZm%76)m0`9*z/PH>*s'^UhyvN!? CB@vFh_9/YS*LMuez~\[Ģ ˆD!-maY<*ڲtsԷ:O0< L~I8L?SZUC'O{he"tpW R'DÜ'@CFq+2r5dR0<ӨSW{@' - ?uXQO9U- HY|Wq5}wYH!6F 5@EA:uTg!cJNbU赘yFnRw04H\2 2| ˼k{k=-7qyΑ;?+pJ8^n}f.QMTؘ"0@ 'AVBc>Y\[dڋĚZx-ZwyֲAOoRy鉭PYc9NmM}mu]-55%i<'*KiAԱ!1R5khZ~H\ y sG`f(wH2.wF&⺗毬bjׯRqRuzSj^}q1$&<sAEs˪QDv Ń ߩ)0|Z1޹5o<``f)|"!c$0h GrwlE""2.kN Ztzg1AZV.Cy PJ?Y _eI7|[j:A3~F /!~zj:ڡ~_>sw數kH 3y{Bsw'K@TЇby!&gs?{T zݣi62ob=amli!!ՙG"V~V8 OUQrCڣ,.rWl?JD L:҂32:t}j@3$i+%Q+w?iǭIwkd$h53x"9贒{>ΦYB|BJ?wo vvg$O[J,*wÂO+lY!˹GG꤆8_Njmw4Qqz˸~y?bi3b h*i~ ʛeroj߽>Y9"!@"Q"sz4Z]@6`X)R *)Ml$dL9CV+tc٬D_(jKo} ԸؿF !l]V+!,6I=Ϟ\'CmZu0fFdFFltq'\7 ?#>Mq5lOF \a h4~n^dxXya% DaM[1z W^aclj(vuk~_:D.K./;ٝP #F lXOGgW^3T(5?͊&-&khzߧ /|{E]h{f}ZXWm2mz zy=5R-.~+jz3qn{Q pnr!wiپtr2ǮNYVOۮEbY3֣N_B."A/k|) d]S%jtj mݽFN;jJP16pG2)C?! Iu6”/ꗹ3鹝\Ai>~xcOB vu0۩3^[ 6+9y눵 \͂J6P}ҹ=|n_<\)A#2=e=uuF'O=&ẆOrZҼ!x^lL JXs^++}̄~Gk&ݱ%YA"AE`NVAqU2ik)r MwG6ބa5FD[;ʻmg6,ǔNE97ZDu:b?nb.-jE޺}"(}b_OY9~Ws٬^+9`t6Z'ah]Ր*oRU"Ch5f{TZBʢٝ]E7PzsF$6Pk3\u JͽApy6% c#%hʫ)K+7,^`fC[J_Qχǚk?D ϏΆ߱ڥazGio8zl<ƠR.E]Beض((ٔsvLlb&քw6JS*Q!cVTI-7JolΑ_~/?* _,yסf#)A. ƋΜ{ȋ!HX{Vf&EW'?.S g4>_GB]8~W53Qo RY]>79Jz7av#?|votV71&uA #\x@R]%.%ԨeB-{g#1EO="*4 Zt8]`;]{?=_iZF(4T2xHFC2n?SnڋEYVt'gV!&ǡ\ՈA'mpi\Fa \2ՠڴtXI9i3IE05XTBJ$U}@b'VC3l3X9Yѿ@Ѫ\V6M!e.e(/A.j`aZ `P,%Jf@@aP /L@ ")6JiHN B pV5҅zVEjhblogqbA/Q2[o:^k^ llVms%]J>Ir<ԤY1!q:a.W7I J%WJZ#[E:(> {JMIos9çuOL{ip* }o׈/SsrP~qljo`9.Fv5)Tn[D-W׮|Q1?I0{ގf& ľCALv&vwdda4ʅ!:{E BcN$.>M}RBIjZdW=/dH`e<5!Yܢ0@Ьɗ>PBkSuaƄ-PN. > 7:Mijᅾ (M ~o+O1qǐ38lF?;gb3$bFn"f4da3]0j PjJ0)[] M#42 tSLMHL.; BɆ`''B@UAA+$sjK ~l\̘r~G7c( uK~ fC ,HH6mHp7eʃd6WA-XK%sp?^e6s43yDgL=Dd bZ3<@ @٘^lyƧ~ VN~mP ѾW]3ME%"ߵAG7Z5U|K*cJbr맞{y bs|͞jz ץYJVkF &lUj8zAlQ5sa `*oxua}lhZx̄^D 2]dQ1J52rܶr(>)(cb.3#x;yL+* 3Fs~j:kKĞNcE#y;ȈkC:NLktOA湝^K4i**^ _ e%R_̧pqwK xup Tc($2y&mcZz9dy`2[C}&߿:{*kT=4a:z昲7~eH~^2vo-rD?ǥtb|ZQrf"8V[H;3 eA/h?N` ! rMsn޽mxHdȉ+- :Q( Nq%JkPL{ʪoYZM l?'tJOEJ,\ i@|+Q~u*FKn2+ynu+(ZV0v˙8{!жwy{j^Ϯ=UUV`m֜io&nGu$aG,jUZ5I&ŲVl[%b^JW:4yҜQog"&|"wEjvV} 5 vfX=0oaac,a pޓz|h=_眔@N D6HTXk]qRemz-]RI7IHV ׮6ݽixXmԬOMCxu(cF)%nLh2j"$@;$k'X=Nfsz<uHºx5B2?u:d> $2*B!i)5hYxytA;$_'nI`) JLvH$ a*XNcML%Px]FE0͔^شٮtH/|:D' 1AԂZaKJż6VbDzV2!PIadKvEЗ<꘹q:n{`7E2\.,NL;6mj^4Ia3~^5 \{M|ÔZy$^f-QMOm&7H` xtr֪-S ^-ZBi3.eb"]qr0;[̱Q}bJ2QW(* 8[6~aԓ:.㘐Zܸg,bj0.)=b36sm%sU,ډv ח1)mE-^IcTӥ j2P:^ Jr#Vf%e@8Ŭcͻ7._߯ vt04:$):;]@E_] ( 9 TL #OnEyFJ>'M9#+Q) oj*#*m8VSiXKcJ<aQ,_BX/JD6 v@C wհ&197zW_0*-Sܼ ,e[qw~.mhy*7*R4oݷH'[$rFxJl:d&s$ nIeВb UERKJ2P"a(т&ám6"|%{6c Lsb̼Ynݔ.HgCpi\̥,xuPrJ)_T_1s]˕c2"=+t13wMWUeڷFyv\QS WBr٪3496ԭzL=}m>]3!MoJh̵5ꋊS]5$!x-d0Cm6Ѐ+;5*jHI,WJtAb(*Vե=Eʺsu,ZVj (pYKO/b&MYDk,m ) ;RD]GY`U(l5v] %X{x]r̍EYZbξy*N0AT#g)x6J"Ju+eD"0gQ*~so~oтVN#@ax)^P-JkKдAahׇt-SmzFǗ!>+&Vb b驋2(>j4cpr iM~LѪΏ,{ٚq%/ssZRZjF*{ {|Z7f4^#ޮ?z&MJ4GQ [X2u(M D[rIgV }sEූ6=דB̂lQH\ +Pg Pt#pڂtDO>}4˓Tr==|D>2I$N2F0UFT6d&ωT'9vShCjˮNeb%Q3Ƭ mTRT:=!L|[.z,#Gm G b걏\UʋܙV7nj8nv~,  خFߴvnl"8i 7#+ㅭnc!t)Njլm#J!D[XMz i$]'^io~]J*M1"xYɨ;;}yf7 - J3 9A&nOi$J 18j;=9^"t`ꪓEhς xf+`%Ŗ@FJ+ifXD -A @r$$HS9I\sxD.0и2ld$"`H8}}W.TG:*ֶ-h&dlKZD``K@PI5v"fС*Eϛvl{كڹ@m~M?M򱯽{i@NR|tITLnU l()@$ݺwKuDZ5m҃[S?!l'9 (-ć##~l4 y"9r 7۶xVSIK^5}&~Uqb+6TgES(5b;bd/\T#$CBD E0CS)iV.)qGa8Dac]30 ͿpEcL4t&O0 mx4 l$t|+}/k銜\a.:q1I9\ Jmgd׵tmߐUW{?ۭh}XIoKSPtko[((? jPZy@ktjiBqY0`ǛK"5W=qnwN"H*Ȱ.jP]3t.WU0zŤSJ҉ Rff[%IA-DLx?'@_&p= HnnIYЏ)Y|4N~z EQY@04 lM$@ 6"ĹP2"!㍯L&imqBMI@B0+Uh뽏W$$[5bHoX^eUUd@FL_@cQVfv6!/KZaB:_WyNƨQaXY)JF]?݃R>K{0 2^C`(( YX%\z|s`(5AU ! TwXfs@"T(4y0čІP'S |\LZ^XG "EHwL(P$f£&~e Snd]&@Z\0c!J4 2ֲ4vՄ L$Y7%$sadC(-ED#P־Kh!ZPYJ,tFNPR:W@*tXNߙ}>z>w.}/=-nUyE/.`9b7H hH(z#& Ԥ)I e>}uyu=3a%ߪw??QoJH$ =Ow9vaLGq B$QPud:bقDUU h(bnᑵ_k&PU&D~] /n1H7 "vJPtl 3Z!(ﵑ Z#s=Ҕ'9B狉 x&6b3fB92ZDi(aM?ﾎgvcA1 )Il&bKc9Q:RtfoڈljJR SP @Kq9Zme.,,H9lcf,!2];:Y_Y.bqNdDv#i9іZ5BkZm%4㍰TfbNĶ*kKLq=7/;%-;͗;ù267KKGR$TF5E ǚsLo*0r]yAmc9.5{te_2@=}{.۵ѾRTe K<>^Cxh+-_>7̨9ϖeh!Iuh0Vց50Rg0V"uO^-p(~S:}}7gz C~ wy$#(+(Y\A߂-] ;Aa4 9ToZ <bU]`!ebtV0,T=i5*ާ81/nz2B{y"5^IV7pRBrJ983Hq 7T"ZbbD%,#䎐i!dȈEtI)%"[P@oY9c 6YdE#u Krdnu|ȉus;-kʄ`[l);=9Q|h#l3$0ښ! cyWb3=kw4XB6pbDJj*+ |VsZ]NځBs^ɾc.x5ʮw8"{9kx4ǂ.qu0cp[l?ϝyNoAi 5mI2G|b2W:W^MWjHdnPBSAP2τ~ \cz,8(hRnsM:HX XZx !sV@?eQ!)%] FpXΝ R0XK-pCԅ -!oDc IAkj{ޕJQv%"I` ҠmG2Мf)sZ:wӱTo=#.CҦ]f*!Q(bNe].߄m>]tgh>K*6,KA_JN[F 5T$wNsڎktZ,ɇ%DֵΤLBAe+at+Ato;mdp!{/c \r6M:N#x˨4t,A@Wf!=Sd֙}?V;Ѥ2\cs~in>WIS< b4@L Ol@ ӨnY>S,Ty @)aޅ!׼EWQxED6@Jb\N3 o^?:99N~UW] rNjeךh(! $ȁc+ MyoU\xg@IZU&!g.9d MjE8)j`"!!ȁD "ȀPXAOk&ur@TA3V, ΅ Оm6jDT!!aBQJatJ/ZYh'-kz޻QU՘BXyTNF>I:feui1k:=H1k[H=JyL\h!]c|-q Edҋ(Ô֫@P'8 :,d,eTd&5R(g!Ii|]zܮHFgpwY~BʞPG!D)Vq\%GO;G>v $x? nbzr CW,,BXHrѤ6Pp$cU3UY09rpJUJ-Tx T Z)Q)56B" HUuAFP@Q 254N&"QlI@( !=1.*ZE(\ 8\bΘT.^`Zת(=Dz: HB*9' "׹am@=AH),%Ql$& -x!0"gZmDn QeQ0zŒ]y7ƙ6L[ع"uF""25‘oPi@8["MLvX#' "Ghp_|$4rh{E=`_A*jW |άbBQ4XQEH\: )A֢Ym8:F5ntci?J+ ߺZϤy:y}$\% `d$zJȭ KaɨAt 4 M]I7i_Y[fmMx'#Nk 1\ᭆyg9fk$0LC ᱣ X*\ٲjDD0]ZA@jʂ#DS!<ٖ/JAuSD)ӄST8 l581<02"BzH@@%fZ]O(/Fœr7hnpU02T'R6ˊlBhkY|ez!R5&`0 =]XA7)tҜe}:.m*9Kr6Xcgb $ןcjMP>׭la1݄85(ƜTNꏢ@T ;']ìQ|:jF'-7Dr\⒭s4vH E4q`]p Əۛa\y6#s^-Xp6 F'3o{j&^<0 <  Vۈ`Qb9VeEQjq//mm*S?]* sK_ 0[t;iO*,9Ű.LTi_^ccvpL%58\[j& "p7>wwqb\xVFf'} )8h7W}ճ:mA[۪v}Slr!# zcqfHiJx7g)+Nmwwo.a49^q_~7?lQjRZ\W`:6ш̶G>A>e߽>ށdbE2 פvWuku"ImDc77D/*Ի5_wV' -"gg\\AQ_v'I0~ Y z@dk%gj+PL h\ѧ *^P_F~'G\~/ױYh(윦X1<{;7Q o7/@!F0TWY$~j>BE8iˆzڣ%Z='@u_~zּayQ^ۨko:1"jc#-c# $E'ey^+9Tm^hɆ(j : ``gIomf{$\qW/~ʽΚS7n  4z[)N;&rµj1\㫄@ng&%.ϮbC7>jPe%52TZ"ndā7n1V[])rdF7[Q?ڌ܄9ZҶF/=>WZqyh:ypt7gTP@̿x?xĀDsʸ:%Q_>&s5Eu]9lnM:|hhѴaSz,ыMeZů6V`('ӟD4 ~¬FWRL&~>n۝P+묥*CWX]x)[2HF@&_6⿲ g_G֓?[IV+b/R dž+p  72;Ke;Pia.*6ׯUs$~0_ncUYm>ݮ*jͷGuϒq=I11ZAWR\.VtkTEěFQ3(9ZɍI)$ʒwTZĖ P @p`I {{Anl}ϧ[;J\ă?c<غxz՜#, o hQDA)]#sbD59:z)01zoafEZ:*<(xr)E֧+ߴ753ZI, \̘R+ѓf,$e)AmW$Zl80 }/A[.Wf`msX uH*xmu />mM)z)X@uoj<κ "gBHPl@2 F4@?]/4mv!?y.n({lK1+0C`X5^=AC(M%sHW6oQPX .5ތCAٯax*P績eԫ測2k;B5Uu~e0Ncm$8 iBB 8;7&ū+;A&ϜfeZ]%u޶fI:ue_"Sw/:?*¿PxjyvZ#4t[헬 (oí-zY"0Z!  5 ,B+'UTYLqMbDEC o 0”lizz=xZ` Ӂ E'%+ \,af/u*&R*Y*D=g2LH%bjE XC-]qFYk(}P6'"t(`?0Jx$U}5 !k`_@qlx^k__{h8R܂1n*@:0@dH $($'vΨ:{91bQobxl(>ך4~0MHnZGBɐ^~uv{kibas}Ov>Ρ`gή2Z&eȇ9$Sxr+%QBéf7aSZ9bQԙ/ICs'gߟDlbͷQ㧒ZCc6s9ro?fmIJsS*`m)=H1šͩqJo@#"Dm%oI,Kg_r!Ve7[UCMZ8hsNg%u7}dQ/BmFAiZbKxfzT~tWAoF_R._G?R4z#3" HYÆY s\it5g x|Y( xU!R7%@o{3 Ш1M60=wFzņ`,}H H VZ&k HB=aKbRb`ƄB~4w_Qjnੱ%jhb"^LJ'uɨp@L{M<Q_wz&B^0Meck/ؘG &\ߣUGg$6r)ō։mu h7M+}VnI`᮷N@2RQg[jYjD܎][J-7!ⳇ 4̎>G6^N` @|%I H6 fـ)tuȜP&CeBTXb,K|]iS'b4 +fٶYzalS1|Bu-^60m ֶ]c0m)#FڦL珅u}>1} ?r䂚b5>en@ aD_ZCt{57_S}Bܲ "mMgX{8~j{UHbSolc*ɺ 5Ã'dxGɠ%$B hN6_cEt+Z{t=kz&:`Ȋ6<Ԅ=)yxroZDOv0<~dZG 5ʪWU;v$WWF,0T"R!ҭ2cZ8C[+pL ٴr!`mvzM6cl|=}W EſyjssF>'+/m1u',^=wX\{ BޯĀ4p3z#O{es2ax>9,w^jrm9|De͖:< s+ۆ5eT ZD0md^`CwtYM_51$U bZW/(ߢnUWm%#W;=6;i{.cmAssx|/"hmd:NObS=j|~\H谛W%hNo" EQ7Rg]=v@DCG-Zܪ4LTX:Jd !4+fSW8N{i{Nf֥k En/k縎6_+M78y߇=}AYtM+6k |uBBp߿'z3y[&5V9w$mAbz[$p .jM(]= 2~VPcPaОn" E}'}4]"(]6$@7awpOM´_zPQ,b%-"ÛF3@4m@(LoU2}5L] =c ].! Kr*;H[ѹk[M>:ˈoZ^P+?܋OJlbzϤaף*O^W'K+<;{:v\D)L1GYX?9,_c˻  0Bx>uon _$a/xlS¹R('-곕k}bR .7֋9<<<0n(b`, -x6J)BCǬ]g@O"m IWW'L$ QHUhL!Fei3ܫCb///f+缌Ú+ 3KМBLDl ϹiaHT;L;{_yw\K { "7ubek7.T[b:(ohئo0s*47^bU?vnVsq$6i u]DTnCIBHfzJ59]Ŷ6=ݡ g{aSfSUN OX[M+{Fcۮ^{kr&-71rPC/7'4 Vg{_4lz| cxhr^/Zc7ׂ@-k!ą'm̹( AeNP_죁: VX7/ԗ "Aj1 1Xg,Zx>|3 Nf$H6.raWza]V=bA';sYgRRr=$ v!0o9 @B+-LXYFQ9ƻ# !aa.L‰USU2ե44}%g*́P8z[5]0[go\arb',¥G\`@Arsy3ځPș+%zʗNɟ.&jU9ͳީM3n$28mo)p8OmZ7BI[UymrVZh6.ȣg{uUUmIU <Y3NeE R<_t  ͪSuJ ڏxT`Xqݎ? y8^?Wo+୻}<78 ;] ZTwnNOK_DVcuj!cղ ;1i,3Ua3 G~Z<;SkxOMTEodqDQkZ5.mGvK'(T?wSgH-n~M sCUu+001n^~&^5bc:09uZV^;m|JakV2sٌu9r[gjk,p@b$.L/*:u WϽ¤l+ NͪOVC6r} ]fTz I[<=%H 1ZIcS0u@G/Mu˒CNmw} ~]>AٞUU[_>2f 0wW% @`t4o?3_eG[,}SϳﴜoW_\h#HO[~-M"0+t?~.R7 *y;5ߺ1J1|q&޽`<<4{Ȓ!a{}gϡu_©7nBOD pv6:3C$tw>眊MNM+>z dd+{B%g'mlM.slϬk‡Ia! BI&OfHAƖc.Ɨ`ﳜSnStH5oHrMk ZT#Mȕ4.ixIG) 7cACg5Թ@L\jG?AkHO^.0`TIV')LTH( 4dgŠM,DqD -ٶ?O|ܴFQWJמڅL-;iE+ޤulrF9E+jAtdWk. ]J )\ H jp=[Ft L2gk9+|/TFrA$CDm5$na0 8rr11[ASTw]b_]mE ӂ`/x2c4mJ1t~o}O:9ݗEl9uoaٺ.͉|rSD;S2@C?~kkcHgq"P~?s;i+kTN RN?%B^ {u[FmrҾrF᪷h(ckW6)N! #3bD?IM0c)ϘZ%ՠUfY.;g`:ۃ 6ӰP;Df|+;[ec !:dE37vF}:AR҂{Pz&(+IzR)I*4DV\VJvWKk) !$t;HUJe2 ,dT\DEJtT "9 )``Jτ X .rM @C4͚M&Zָ2 Zb&,L!(SVĴ@`0!e fqHl D/P(RX,cB3|Ba5BLͦk.o|<>^X gG|ߦzĐ$$3q^w4})3"%I P?]V(3/i3+|(cvYcN\֐7r(Fd/B .?ˍI0(۝ikYlZz*\$ !`i4RBSO_o$gdʶ|?V}*1<,_뭖E37:@K [$k6xNK~m7>ÕhA3$^TT+LHՐu,b_3|)] :gllqN_ҹֈؙ\<{uGYݍiA5<`]3 ny? Z?g9)![bWʰn=1?|op(j[{Z9ֹV[G,Qoky85YE:h] A8^R-Eےor[҆F#EUpqCIov<8pQm>3E\gQ⃐w =zN\9  *ADGk erרq2E h)Y .~}gdso/s\'֋sjM[0uhD-\.iԃl?_/ W=8.i6]e5wtr1YV wۈDG m+i,QӸUj0#7l˼^op[ɗ-XDaZ0MnVZ_T+jӯ>3ٯNM۩a9?Deb}F8D=jg]"&p.AB|YfGL3;d)cdRz5psj߿" WʉL(/'zn60i3X}ӍYm'}K_;TnOiV2V#ۀ'CqF9rcGXN:A׆3cJcGύvFzadWG R?]7Bw4 xuДK DM}A=z}QdL` c qh-a/s7&\n| ۉ(v(fi1% ag܀T6+G:{Q']|'mM0PFp+ DkJkWTrpe/8E)'\BWJP,5 &9ET(F,؞t"ZW3_Q0I ղah7!{JΎFCie> G;ÇfS'hDt.Oz vf0>QK"ĠUy\10"5Ӊ\P慵= % &_VVr"6=bœD,>d#W4龈Z"芍^80-Δ)Y|;W.8o7 hyu*(j1ؙT_ٟq$840_ V[",nenhy&~&6/K ԚdksYՑw ՊȢl%{ʪe h_[ #Ig\%oU(䔚0~m.v>fРWu}J/)iQZqwڝ$jRNU UK; .a)>7lu/fOr^Di۲H^iO,xf}S4MbJ]A*QC[+hto(짟XUhwkz'.>e)6MեӰLBb!٣] VEDLfß hgl2|oK:FUAً<v)s%*Pڵ2N`qnER( GDNTN;=(FNb0ra *q![J<`W={bM':GƺF & 3)auNUGQ$q2¦HY/XJ/>"2Tu#OqrEF2QD.꡷{Xj 0PMOcM3  e~)fmF欏YMU#zš i hgkqN'c(ޕ \/02>FV0S%5q7>VXiv9EP26l|xMҍ_k>gK}W6"+IATJItj,IJ!>9C`ɍUJFb_>;pYbઁ)folNqk`ribAF 1Mݼ"Pews^P]k.Bv 6;X)vMXHufRZ )'/0vنx ?8`&r֡["/#F9R%\R?i{kxWǎOP&LReubEZG#)wM}XPHp8RR PUhK'<&KYfAWe>k3~e7}}W+:#S/L|Wi7bXN oc)?k~{w%RoiE^k(rӺuӟTԟ6M0nml( uVJ`cwlHr][ Z/(?^(Wh1UY}CBOhL#Q[鿻݋_v/QQ0!oINL6㤃bQdH*M"{5_=rYr2kq?RuQPYgU>S$0QФ{3,;JoHas͢8+s u>W[{@ ֋rmӮR?r~5@:=D@h_a::29P.Ǹ@RQ_ glJ`HUSZ4)I^R>Mrz^Lvb(FRPaIRܺx @I-Up`p@"Fq?Ȣ /yPtSkɑQwPߖBa{Dbf~Mf)plDTKXőuӆNY22F+HZ߂וSZ >h *%h/KJq[9"qZ\䳥q08ƀ.WfT4,Y>RE3=<4H惊|)1*!\}鏨ee݊s-ƿ;c|9#G`5p`|M՜WZ ]pݜ03n}ۯÑ;P-?pmыѥ3\]OIՙt2gN(էX z؈3YtˏӍ|~I~s)ƾg /\%6bѪ 1\Z86N7mh\'x{a+U/whA N5w=X( ˠeR2x^o:t롅 \Z̚;]j`}O?I1[1ҥ2 V\i$lҨVqyy"L32䔤l j(UF:tk$UNn0`X7~F8G3|5&D¡8 6 ;H[XG5?/zQHy>S9aDv p:Τ ߄r1L(lD4R7ٲ3)yo!d֟6Qs&Ф[-%Bs'n&ӟBۃpw8E&GF4t4>;"?oNECK3 `Ap+bmL@ifrbiyM6YGP{oڧ^qPiĠATRٹRr>U\3i.RZ`}1)Q}=zT}"qj7D xMnuzNJ:^aI x7)[hj,- :%5q,3?qDrj|%#LzZL@2I$>h"Mkp3LSӤʈ,nVU^ߊ"̐+]L4]HζY)PDkA+bJW>j*% @ț^|26NaK90k}'ڏ_!Ad`ܝ0M]THڅCx!ĔbǥC!I1~ؿ"+%!(1~V 9%a8LQ晶`#1~:-諨9ir4Ń!tAqT&s2Ot(}@xMJL`y,FпJ ѰFA|Y܊L-n&r,mPEF}EubAr@͍K@ X Èu?_1[WѳK@(X5Rh.lzg;ӐD>tp{lcC PlG_y$[IMA{'J. [ni>{+b{_=eRlf0r]iI0>,e팑}?+JꂺB+s:Kym0,&G&$$ AB%1ͮq_ $X^XU V4[oLTҪh (6l=[5o"Dw"a\Jb\L `UꟀD9% ;$UxaqЂ_AR+f*˱d:kT4oPM f*)jP=iIVY0D}73ǒGS5{يTiD<3,e\M =FW70Jmr5cy~|@9fځ6˗۹U6u8NTrǠTik76K-nɜT~ lG ÞI/ }s9Y . 0j߽9Nf#:P>pq{b9RPDžTF3V@C{C?w_k#,PA'.GhNA˗fr3A*.Cz/o8S6K}G;Nb]Z:y֓fzxh4iNwߩ:Lb5ɬ},/gyFЅVc]Bm'/3`gaQeޔZ۔ &xũT:qAC,;SZhA{ SW>%FKX́N^/w836RP_IEE*mܾS,[pzЏ*4 r?jĆOIMQF>-f| 5& 0pDWT}~X ~2k6DiӆoX2:BF"5@&#cxHD/~ BR2 Uŋ|r#9x)Ji.÷Jhz << fXIw4#x}}ѥV]ۀ<fD 's=5Z2Ǐ x'>yCq<q Q`cG\4>j*Ķ+^3r3,8|J;@nmw{48`9ovےck%?ٛZ͡Z[ *VZ[y=r^J?C:mD5 I$ 薧cO|Ɛn ؟&B5Nj|18­v|_$Dcӵj:Բ*_*I`X$]~ywY2 ʜB\? I{ƭx4I!jε+; CB- mQ-qܨȩRHuKwÙwXTWO{}ұNqr^'O@W@Qkp;]=3u YTtjjηb}Lꨑs(]M"hSvf?|Bg [PDÇ&R1xʇO#gxP <& ah70(i,Ｒrg׊a^tjUEMv>{lvuH]_4+] Pֹ>{ʄ* 5+dW6Gw {W30Nit%(wy仈 Je"֨M]rT5 t`PߧUw9O3v wMȑ$9W^i8#,E$sz,6i#=$>~ll{tGtwE>MO( |qXm9,;30,fLܵpEwI"5,pcDQ=4LW %VFr@>I+SYH؊FD snu,Jl)go Z;_NVi *Ooqڊ?=['[+wK_b\j9X:]з-NjFpД*ؽRA&lTh9E8s$4+ >Bq]d8aϋx"1TEge ċEꓭ=~YPMhc͛J52_Ϯ17dꆩ]%u/`|#emb=aiC= I|lBx ]ϊ8HtqѠovO[uN@f1w%`24՜T5-1 ٖe2xB<eOZKOkI0̧cL)OZvzfk/2#QwOꍡ-K@ ;rD=}3\2*xINj^C;ᡅ7 hjNWtDd6eeދQxWf #y=.Lo.4"|'D"F 8ߟ 9@^wX2cXdܻ2ٟt"kntqK,ݝ f7IT Ok֙3elZɦQ)i?57{,„. Lܲ?TݝmШŌm-T?u~i^ UtD,59Dmj~@-Еb$Л5im+)gSb5{; (`D^m:&AezǫV\c1=jm+&@$!seb%VlQCU}qd96. |N,4΄P\ RF񼍯e.8D@Q($ |lQLrz'Փ࿸Mj8x5Ç%jD7ȼTެhʳK`'_C w.U)f)Uū [z*dZ 9i5Wj`3d!|9Uk(,K.ԦBfb8:̵HZAՇBKʈwMs'&qЛ)C}OESV0*nQZ sܜ"ifw&ew(JXZud~ \|HI.MKD\D W'/bͰ2(ʎ!ּh)l0zEkQ[E 7丒UbO,%SܓSR4-`fr'K: 3)A+rr ?4/lYQ/3cՃM#>BhML3sRF68ѳ٩z#;!1̴&$ ;@ ?H*.&aMmkլQ pӞg\SLEjG[CqNfиv1\e1{t׭ܒQ\HyJ3cgIV4FA1*1D疾swѿCRH2^␶t}cdm(:aA'pO.T쾗Nr "uZ?2qO@L}f~DGmUA0#̦ϐq8dԪݲB9В γ-mڞ-{k^9'əXQ|f_>GY!釆g̨8(A{Gҏ 4b}kJCP%{6tT!U[}p7`o~r߰EV{MMl 4\vNjȮ8S5K (wڂ iN?r$M3wO!)ܛTr˙||騂=l9<5T*5M7S r(A&(Fd{Jv{1XD C^da xxn <\Dz5eŽh?n]G'pTv .cq> fv2($%`sm)œ=F>7.MOOz˘WpY( pr?-I1IAi/ QZ.%'m.97\l紺6km3`޶ ?[jʕ1$'ZR `ob<9i>Ds<ɚ1l!#EP#B{8+aklI ( :%io7G#Ddb汈8 _6&l|qo<ȷN[XRPh,p5x?9"vC TKi> P]67x9[%Iڽ{tff:^o >Wn+_Q{p;UsĎl13 ,]8 }sϸ m $MeC\.JR/pW9dx0lt+Buqx%$T 3Rt=eXMgdf*U׀ ^K93(H04+[FCL)3eD|41٨p̗ě-|S˅WEygٜ>NO2V|{bF;+?+ҨsqPJ䘩`j7_ fe%̱`AW5qIZgdv)4ޞ$L;ݒ4/hϴ`y-$iֿ>4K l Dn'Ԏ{I`[5aoJƮ'g=wd4I 5⼉ -xH{B$5ďo[RNa6<8CȽnݨ5h&vU5tc>6s,~M!;K>Ktpb"v ;4)71y65S5|t{8Z;h.3r3bŢW?&Aء Fq8=>1 dGXzƳ#`Ka\|4QC/S*{c#^ET1ح'I+#EGOID@Y$wiaOE!aznGц(w!|KKs~s.r VzkTKp,#W _MגB\>WDN@U+p4A?᥁(GX dG8 @,T84OXΎӉFx&N-NҴT%bÕ0ylZl|do DZ/ouwk!U2.3 ,u(F)<, wkF=/2%`́! a  >3d) s"D_M^`y:%b6[;[Z2N _%֔aGYo"T\M"]vv9KPA%oGZF_'GM,\ܤToo@N (Mwr5coiX'rB5V-X0R ؔHt}i9ƒiD*ۈ=hhqrWF&F8 RL?ug7NpKN7xtɡSCfPPv2lf3ҕV.qrq0+}i-y*i`Üc|Hv(gv(o^E\+_s^}q+oef1g 'M,~$H7/7$hʖ麅㿋(N9Oa̋f' T^ߢئ`&KouM9f &R9r~,Hf-PI+mkCQj;l0RXirK"Z!}PM }aZ-,gQ^c%+utn.0pЍt7b05t_8V- KBIɵDΐʣrm=%[:fóg58dkbSȏ}nkwhG1.,Oh$ي`w}Y9X-{ m >>N#R͹_{0W˼|żZmXq.Ҟm4*#?02rý}$PO/V@s;Cp`C (0&Xx7yL/0u|R( '3G4ŬΌ|L" CI Nx`Aib(ghNq){nifRHXv&掑e]bo`5ƏG'ϰSQG +je鼄Ea- MGtnd8s"xJ<7g԰w%߈_,ȵÀ^owܶi=(=IjVgPt5q A=m/hr -8XunFL$ZǎTl٠>Y. 2ŬD\?Lױݢ3T%@\M ?R]eֆI]w_CuG7"QX @bEWɝ]Ƴ7Bƈ7%n,"AQ$bM)D>d2 |u[PhEZ4!O@q+,tX(9x$3i~߈Lυ0O1AT'a>vzCT'~|#pAc:MxЌc=~yD@ ;U gpa NA{T.8&@Y[.]NZ70<WE+{O[%]h}؜^xgA-pqadPWXHԀA./U4.lԡ&/T% c/ܻ n9o }EqE^J HnKISq;m&qetJ$O`"GZ )™,5~"N@U ,Kg G.ρAx3};Ng{,`Ĝ$ $Kq{FAbl/ۂ^4, xrXO_ܐ@%e z uֺ:E!F|ABDՌ779psq.|a{aڣE2p]Iċ~HuT9p 3ZDzbZZ<I?8| 61C 2%Ʀ'r@YA+s,W< UEgh<8"O+,TkN8ztĄAkT.mD#H`' #K@O»z-! L_zL:Ejn~'2^YE`qXjh;s|D\hx*{yZb"Ak%'lo rƥeUqx6:/:~E γ? vM&g?HL %׵# . PH@4q&~N7$-|n 0q7bA3@`MrH\oJ(Az Lu6b6Ts$8d-wk#Xʦ6`&m3EuE  snLΊ⯏Ң<׍٘4] N~au(:e:IbsNta絀j;qPަfDs7Ĉf-pRMiԃa`l)rIt_6¸;Nf+:=4£Ωy`LhVO%PKUݑ3[C~.vl>z4H#z$ M-JV:(yMn_[=~8@eŲe`iR TRXEw|6VY;#`pڮlpwa#/?9MGH㶵Ei~^\}PA ox]~leZ.qA1> M%놌_w2H_R-kO߁제 ύP(ʔ!Lő;$\JKTT&FN>𝧋<_P 9z0&01'z3Zmu@-XCVoSћh.'j'.QEM>sP\Q NxBJ֗Sp{N@4Eq=~ I~Fu.t7W7®VM7>2(=-5T'l7tmN Ϲ=3`Wm_f_@9C,7^@%kAƩ7)(s{'XX Um2hʤ AZ; LW%**1̵@dՁ'y20+"--~h]Ϊ"y|Ն+~ka 2 UI[?߾VIY:({(;]c9"/1huV+\d&>G!\!|i0X+ ꮓq'z tޅ{vCQM+ Y>-nEXQwG!pY@'[>%i@XjCg-{R1`\qh 9`筒,ydh{Na¹Ƭ[) |AdHe!Н>od_JĮ86ʏeSL!pDyK{sHɆX pƁC _{ )AAL?hĪxޯy]^MQwQoĎU &yJilqͱ|wH'|IobJ즶$)ھzl>!&1T fWʋ=&|/ KQ.WSrXObgO}/BM!ı(!, Gz%oN@H'53mBu(;fhvNQz!S1֌NJ20;4 E {HQ1vWXHu,e =f}r;8L DJ0V{Q@"aK CZDLӀ' 5 h]=_cÞhDb./+D tJ3>5ʗ}+yPf<,\)+VdnȴSFX1Qq\fȈ3Ax $yߕtڭx3?S$o2ʝTP(ǷM-|0;UNE2? ,߰hv/nBQ>Ͳ!H%,뱆3Ǽ^^Q+7!>C(!e;^A8Y77 ]>>́ M3ZrF.hĭI7Ypo]V2 4``X036DkAE5F[`!>,-,{Ɲ tE A<Yѳn sb 8 zws[xpAWV_v{4M o7{XzcHp]/ 1d KtH4R Rl"g$SZLGrPx+;ސlD3Fk*7?cExn~dHIT.=Kp e}*phMbA(4}>ә_h5Ш;`o{ӏa6huW41vzOXף5+ȩm(sFۼ5G+V%؊eAQ˱Bf O(b1|2tlhrCu-iP"+[GDlxo'X. +s ҂B+ Ed%cdQ/ X!G\Ps<5[f_݃:CiSiڝ>fnٶ 5WHʙGTVxNRd2N h$%"}ŒCHspz1ۚ $dB rD@I8LӬrG(|-+$c'nN=59qW* ,(hĄ'= Kq);ۏӐFoF` :l_\vQ.NWx xsؘ7zR .i-A•´fKZ-peÍH}* )=oz%M֗Nn:U4%e侘ȟ sej>'  :MoJ" NIp)t> u<XO ֚Njk['s)z=яDjϑkEՌ5cbIK}lw>Rܪ)[z<+obw_gђ_&Y 7jvfc6vI m/Hn>/`K" z}쨨"+G#QXQ%B3q' a> QLD.v'oB*FVH2QD`D zV暿3RM%U lZHvF[g{GVVI'9 +{YW։{!rN)$OHLt*KՆWc 't46x~#H|^ uc=N/x5qk{Rݻ0V{r W4I?(2sPӌ6nmbS~;a&^F'e ylo#%L6$p|Րp/.G ;]Vr"/7E$8u:j1u8hyVORCVn8p/gp`YT/{ipv? ?~8w2-!v("ߜR˩ہӹ9Ok7D|Zb&ɂlI5'*UںvwY)4w}%8(%HD`]LphPl#)R@);Y{9D| )BW8 XnR&9Da$|aJ,"gHY/(wPa$,)h ]@ZƜ>Kq"pxmL?J|ؽdCe/KAHĚ;8$>s2. qt3+&Q jrA=V?=_zsLnVirJ8Qx1"-G  t_z6 ^v:~E2f? 'Ē3 :DnG+gIBA2/ԞR3fnzz7=s1Kp wsV]ϡKj/r,[6c~w:yp_-ϫڝY@1܌uҷpY v( 'fi1nt6+#<l4ˋٖƑj?*2 Rf.f*ܕʰ[),?%uVymy+rC.4 xx~z"ai639uMv2S\VPbV~ 9BG vb 25cE- m"Kzw?qر%ȝ@V.41BxD_<>Xe"i;`T Tyݣ<⯊ϻb;X93;Da5>﴿3N0$)w@"T쬉OR["s17JmL~t=TcBP1,,:к71`̜5):݉ ˟gO.3O?GC1F8+xu%6HoPӯ#?'y~',`+b"!7} C#}2y%o-`\n3xEqB0,j"X0yј 1yRv(Q^IHт:N˳ }3~v񏭒v}ܴ겇=C*zwv9O; _7 w(ROD.1`R9O6ܯїwbRߓe!wt"|l])@(Y|9-Wq(%ww{t /Qp}̈́`vT XfaOnqz$uE`".# V]Fl'X]2O!~'N7^$`8(Ngev;ڍYcsK0gA^ 2B,s\ ^ #2ЂÑ7[|Ljx9Wr&!oCfj'T1b:jgٯ$9"^#6ЍDĢTp~ [7J Y;nD;Jn4,WB[f4!1=źTp ݐV͜~bE#詀o\ Brn@:-4JFمel)0. '\ϏuF^IuDgֲc̸q$O YTPRnWCj5|x uW4h;{+ *bĞo;GEf`*jԑ/qToM\KMݺ=mH"܁>/XvS& =t<.MN A`{`t4[$%Sc.GFhs.k&3PV_ ^K2dc Z v_9KCP})H?+jc}.7C0-rcK**]la!L<Ԍvd^W[#iw꓃m@v9 tlab ebK>l1B&['Ɂݣ7P,Cѽ7^īddF}pza p:|.J>(*07+_{Jqoemf]=PF] 2tA5L;17oZͲnL=?qM"*DfQ\+y0cؓC9*Љ+;J$d D1A`M^0=V1{@.ʿ#N7*wc>2&ax@Cƫ0lJ*ҙ(Qb͖>\8,>/;Upgu7dTey`˳E_`ndxG']Z^};'vm<2$bZz.U{V&[X@m{FPzd' h8m}R[v@!!Qo\Y9^Y*ą:l,]akUA\cL[f^}Sf2ַ#Lc("99½b=3|J "7e^3XZ=M[3ĎqLq 2Ȧ_"5\Ph@V|3 H10OMӑœ/{LbPָ֣ &U=*Xp $ -wsHfy֦znLQE-uu#EH@7끖m 8j#b|WbO18'iQL_bJwzfG=Vx6)/GFטzp&_oj6Rx֞k-BmUA_1%#]p@M1J+` _{XښQ*lCB#h֎pܤz;%^wArk$9b,qI= {T(v)Aڞ4{5ʲBb,RgQc9VIr=qN#}_?$تTl'R> Ia=3Iη Oo]ePgd'j?Jr{X٧6=wH<VߌȂSu" pkoR1MoSJ oN  ;E߾>6CUR,44F&ܦMٱFE$wa5{vٜ4)I!ܤsnUgF ! y!wt56UV8G%7MW]7o @!!YV)ev/g֔|9u'uEa<w[Ax~2 3SM՛U>Q;7 :'!,! ^ \l}*_ƛO|ϯFŷ7Ev]xx$১t>O۫t߄k/lW@\"0LA!d5n _O{t`b)eU(tb]F*AOb>?>ƜQ;IhKqqG@]K0^ц91{mM8L?QI{GtRD:I~h.A4d_$X}ZfAA 7i@7Dqg)F^AxC,/),~/抁h+VTI7ǥNxPzRCwpalm*9qU?e&Lޕ(L 'Ify= AYs#`(}T*F,jA7fϿ0"d/Q{֙uLaP.e|}!DӳH\"y~j{N7&@211\LP XPZ-~3`"[aBT?.4_`;Us[DͻG< 8 m\}B3ˇ֦H؂ "h[ptQUс uoK\U ۻMQg+['?%IeYQ/8Q2(aL8$>@U_1{&Mp4 ]j6,^?,/?a)3:ţ:5*:ER+j-_uee WRu-@A;za@IlpӐdbh8!+8h hxzo4:0hCRSb QrRࢿ duT#'aC3'L.=CS4D@q)?GVަF;O̔ HRaa政gŴ-CrpXK^[]&`[zun5Zw XoZ[XWfjz~gձ4QxG/+zBU8x߼dzv"['BӸyC ?Mf}Z)-+0Q蠆oB+-C\&r)WE _&0Srzќݸ@R%1pdԞD/)ac'Kwc4cett0Cy #d79jsoVcaZQpi&Qّ7pu;֒$Fˢ5 ͈y,vS;8,AA8pڙMQxл6`1Lpsop3roӐRȸp;KZUx< h@474PjMH^/!Bt 7b},ÿ<+^sf7tf<ݫU5 eTb@35pePNX) U7`a+)q_n%*Qg:H-I ༟; 2 ,(Oqf6J}l4c${z\8R.祊N{wLQR, Bf!4Ck^*ZhtPN X"|t9BS7ZH3)kArļzI.R¦q2aD&YGE2t*sI w ީbNMX7f|1-x69V@HnJh.q9S_o`[P4 QZ{&bh25T؂w(® Ԓܞ0 Q2p4s ?(M<x%1lFƕ33IX2'?Ilfp.n}[3?6jGQL+MLSԅWȀc}psЖ^XrP ze+*|->aO.7w\$~p8ܒS$Jk1mi[O` N:Tbu'[Z3F?xd(t)>ze8\􈊨Ztrײ8ؽIX*dsWw2&;k}gwЄħL94oE,E!Dz%@ .(tFe kd%. |P*/YTT1|2ΐ^5ؕ`]jk85}. ,b.ڛl4#E'b,Nb CyQG蟥_|{ё ҋ{"=x-l.x?ZfTn^uȠ!4ۥ6qbR[q8)n T Q{E5 8zULA M]MѽN +0 OR3cB?PgG'3`"]-%YO@/E8n9Epɛ0 rWp󨄸'-G {P>sʲ#D*t{s3H xBv\7!7DmVT4K{L-SQI`O($Z뜿P]THQ:ZdRhu#Y{<Xī&5R,K6P6x:>裡q@*3М |*TM26w{1T]z bLe2U)F%p\j5)G}yf͸ƍrܱ*in rM׵*1 _qEqѺiv)#2G"}a~6Wj%˜~>l+xbzPCN\@GU E;<+@;8nE7q^_^F0;ޣL#b\1{hp{m+kPdӦzِrXQC+ >37IF!A+VP#_ˋE\3]䕳ar{}W!Ⱦ;IR;lxA1/?oy;7ub 4 1LJܒNJTbEܻ>^oKuD0yAeA z݃ ֝b 9 PVcZ.M+~5֮6 b?y1vѦ4<> (L!WÓLELP=]1<7/* pzU쳸`荜ǂaT7l~=\,CDʓDNw#_+:_eԬۏ2U2+3 󢐥_%̚ ONʂ`RXlFD]i9W!&4 dqל A@ZhCA&wiWG]ҥJ''SN[q[>lmyw[6wnuP=by ccHbY&1yM`3!/ [怨7n ]@;h='=_ &je]~3O kŎ1%Bhk@&vÎPt^ŔcANt_Z /C-V5y=d ti<%ky]oX-bOk]ĿD2_x^KgHiO@l& RR8+:*UƥthlDBMӧSm‡O{4wOH$BK0ғkiH=rݘ2< {;⍍8ϱF3sY@u+2l79Dftj?H0Awpy LFQu}u: "0ܩ#qd0VO&!3ᥘgj/҇[Iˣ[5e߁dQ}.\;[n 3]1[,W^{"*S0Dܫڍ'>{X4);e2¤"3; 5ndߋd<{Fn"q3H~C;/j(Pỏ/B0YhKzYQMF̮{p^>cvj܏B,3vJ㚊۩n?ɀ$2MT 89&veg(ff>uT ?LL"!A4؝y>IAkx 01\3hr45T}Kz+ѓA/J7&K.usi^ﻓ ?gnbH;*}TrB@w@EEB% E\T&Xƪ( *+r.ccCjSu'[_꾅<.`*r?XM+Z=`|a"lzi(lΪUv1:>X0-(V]Xx31ÛJ2Rе HR>9ÃL),5灶sH*eI`7r AD#Æ ,HT#qSMt-^N"v00@{lZa#YLD0n"3DIi K QOځ&EwdqZ24 \ڇdBs>c_V9ղmsq9hxS#{ּI a]LFP6t '82I. +`U=Wz2fKomVgc0$;UW2k$0i-CP=B4ML ג$>mlxSÆ%QˍMgT?-sNăC{  |5p#6CӆY eN6+7ն2g`Y=ƿw?1N?7$ː6{Y_*i ~003%2;m[v=֘ ˝moEXGsE$#IM02w$n՜39yݚ&IWvtyß2Ƣm2Gf|*oZ1" d&dJ~]36Iҹn䞻4E ], 4Xjqo쀼𖻔D(\,mԺc?wIEXzv@JJu_aX<!51[m&<ؗ"pNW[V߬q0yL ^F=HF>֋,ΎJ1A+l3v=F9E(|Nw;?h:W(ܤ"vd,*&C%!P(0@AUaoO*CPݷJ#OL@T589Q2R=YŬ8_V|W)UZQhMR+^ZL g6X?58[EW|hW͍eS;j8D~N>U [Ne]~*'/5E<Dž rmZЫWuW)ᣇM)Ƴ턂3qS,JF#or9sC5u+ ;Y_w-tk!Vgǹ-mr242K$Bx<&LYKt\G$u(pRC _@hm,y MSXΡkA*i~^em\Nji!56hfYr%OGהbP )" rJ[DvqT!LΣ0Nь.}Ē5vJ9ZԒjNƀԓ j#;+`9 m{]1TvŔJ9K$b'fm=M_ZNV ȅHsX:fVbqd B n :Jkf$Tu߱#U8LH]+f&[{P `r,ch/D aOwt97'LF{i9re`^scϼ"݀~vMTEçY;|Ak[}xoBpPN2s,I+>р'vOvְk QFЯWE,ăݏ_т SYo'r{y;}T+R+6eBJZ09cw$ߤ*S/{-F[G ɻͭkpwgC*/z;f実enuGLZFWoFh{au`GbMn 7{S]yt6xIaߘ2F }UyBQL^f j7#p)T>*BCgzZ~.҆xN{6slFDzFW֯A"Ԥp.^)2j{u,1O@~R[a>M֔blFƉ |AA}^ :\w~#^k}3/S LÉQ㶛h< L-7cac hi̽OV*j]Eѐsn`e<i#CM;T<hz?=7ñj|Vvk;L8 3hžvnrkA 'k;/2`)ich۸0[5^1ֳX&[/ֽ7< 3"'Q _̂dۡQ,o+vL؛!̗i'ЃDy=3и5mhYNʪ?o"(pUȜhG.X˃͎xڿ99&K&+s ܾMw7B_omպtWAa~D9M ZEK=)>f0Ag5GοF*?Fҵ^#$Zj'-x2ZY2/3H?ͪC:Ũ4ž<@VF\2{T ib^q?n%;z.ױ$J%=(ۤ]VXjR]@Ft[cxG+n $%ъ%A k8>KzO%+$^FFX%{rgNhZTY0&)Q OqJ5%zM}hؓOUĮy!kh˷INgixgH4Y@TQ-]ƒǐ~B/C zc/0gcH+50\r>VǼt9G,0YLҋLSg{x$ɯҟ'͡rj^گWd=[tr.wy))w6Im6I9_S:l)s!re4\(7Q.oP,%Onau(בoZػgp_N >` ItVKݺ98M# |zB{>@pxkAMm'וs1\W?-Q4-}nA QAqZ"FBz^\!r߹l!1>~&M*٘|NQըۯj9ҟ[Gv;?&-4jpmanjjxyj)\&Aw?U 8}ӻ'ٜOhwGpL ,W 3ZxT<|+| {"L_{W QM =iMqE 8Zo9:C5LobGy7L`Sk!6ZS k#Jmnoz#:IckW$VTo=ttm.LQQh,@eLȦږ1$OoJT[wt6NX6fX\-K̃KP+=g-dJ-vX:.|~re :IY)q,QFnK.,"NwQ##,bu[bz\>4 ݝ|4{qg`DEې)L2)5FaSJ$!l3δgη=1Mizz>SsscvE,9O(1ZCεǺRa 72{GqS[ޓ, ǐ/k(@[/%Єxs 0Ʋ|aA.L >8w܇Zٙ),O.lO?ٓ^Dۍ5e/:{rL&R}>]9Qf$KnM@𔓄>2:(t qa]1) rfq]'\EN]+uaV\9KUi3'q : tD:?w7\)91$hsZ D4<0ePh3yҼs޾]ETa[2QXf` !fPe Vf\ӄB̉ ;}#$ttU87BYHյMz"ͤi؉S ],*eP^`W`SqY8BXoD$GIZ^VDK7:>G DoвE)fok2䌨L}9Xs b9-ld{(m4;/O|@'~q7} {$o49i x7"a * _G]9Onb%lg|l`>ӌ;;~s7p%ާ{}b(w"3s(JD+ @f¹GكNGw<01(S~b[SԳ&TDnU8Sk^^JLkE½8'P}`F a`aTiX@`Ǹ@7$,GnT<"'yBfs"L߶B{ڻK1tk,žxv5j?[]'aqQ]2ȎRG [¾j!>y¼u J/)ic/ǝxdz[i $#odR`+QgwnK }K? @*dq6&6o ZƆa2_zÕ Bpahf&%Iಉ||]u+JZg01 pH ؝ۼ"<7%L2{AT*EI69Y&t,Z2G\¸G q6j?TMs/nv/<0[rbC.޻L;] ,8Kk.9Ch n-;owI %פڄmd, W^#qu]e6|kzhʩbUșWAѦWm`DV./bwbWM ްU/HA1MT']!Қzb'Kg=!oC kT"2Y]A(~]dEoa֞C* bV}Ҍ؀svv;da}3xO/kW#*2s'B7 \uh`WSS)%>T73b'JJ,/ )kvz\*>.!TNM^8:@X g{+RfRe|32~`R-^6~6!NMv`M8"SIfՍ$[ӗEw40K+Vu*S;Eq!-yAsbI`Zr$qgV_4},-^!1 avȳ 'IZhVOr86~8Z hQV܃H`2 ww̪zVwMd!A{=RU }oz_=>t@3G:7)!cQ!>FY'^m] >PJifƓ}_˄fc7(EocCջ>OcƧLa^˧6gfki%Ks*S7˛LbT{j-y g ug 7x>D-偻q~b W-#B |/VR:ye;jpR[d̶w;:"~d0'WA*-ieGY1<ƉvSU{&5g<Ǔ+`TbZӱmrбÄTC{&Safzb7:ċq7ѳFN̂zJؕ{c6E8G|2|xb 1Mqb:fT'e;|u͍8Q-_Ñpz${ Z%Y)+<^kɅ>`/dsa$ ^lg39Dgh;w)ӝ *ŇK3@?NO2 kKK|Y48*tr9ZqHP_ ;GRH9 -ytcdW=B-ޮIGl,9"!1r@f!8f^Ykm"([bN&XHqqD5|~g$V2X󷚊}Y1:$"~㊊2t7 یBۉf)tû)muڽ嬌H553]"vqq:V>ڰȶ=j4//;+fiHımA8!Vq3lzg,o=& n,VP9B_rȆhw3kĴyA"7fjd[<$ζw)2À   DC–aK?G&@*?=b a؉Kzwp LZ< 2;rwMgkZI%&|zOn:'ug,br*SB\͟t .u Rvm_PӤT{ L:}f/kq"JǓ 5NjM ;5I߹U+ڪ*->v>n_sRe+g2j}ɧ"1tnkpOXEpRiB<#y簎rF-,0f:{ksJJךn5Mt^B`\drܬS86=7Q)׸Sifu5utFfLק] 5p32Cg&>IwIAS{F%xSx.~z /MnWC$Qzgu Hj,1X rcüXסR +W+# ~Vtw-/BK L-}֡mNA %uKYx>9>3 sjwOmPo$Q)^,kCjAQ24In%D2Y~9x|4;y|>OUϣpA*$*3uxŒ 4%Br-g! F;YsjEKOtěRw#ҎXzlm&X*aI1ybDZ׉v>(F["JzVS' KSu3-gĴ#mVzT(SdHCSoILԭylƬkԧ<{Aekt*j ocN^9K͊U^t4%fodn.sZn }荼oN✽E/ao2s'Py|ЩՌONC÷7WFt*[Fo27'PoCJ߅JwEK j`x!^p5HKf̨w[ξø-дQkU HSJ5䈼OpiauVK@)YÖyc?" nh\x6s=0(3ƹKIfo԰KLM\}IlfނzVBC?d C$juA2UQh;pu1,G:ܔegِe4J8”[&{%*Lj߈E%5a=\ CTC-2l׊&)b׶, 0_.&AV.pe#CPm Mu("(cc$gߔ?F4\Xyiz "dŚ:'Mx]u}RIn%5hG܂D*F ,/n7>1sAs45@M.p_ 6㛶4޴# 6 F.LXw,*xx [p)!HD]{c%|ӎ*qjz+sEgg94݅^)5jcvfnuQKrzL(/ Պ6j-bHW#H3Xm 1kVדXU>`LX2fΝ >ރ-cѤG_;qȬ pȏHB@5+da[ TbvK'@CC=+h-$Fip3@v2#n@Fۆ`M'HFʧC=="D5phƳQ̵EkY"twIVM4G~HBވmu!:6?л3<8Gz=ʹM1&\O!3qfn;jbnr6_ˀ5TJH#a/*I[8"-$sx/  Q(q"Dq y߿eQ쏿:HC/\txFwcϑDkVmmnIј^/)WahgĊ`ydu"Mc_p;吼+4kIZ>r]Al˺1%&2J>/W9ܞk =goFmf"m(0R P0dUL [˅j*(G&JnWՐ?,2$F[׼*g_WC)`А] y.-(HMsGCJ[P;J Ӧ:03onc)KUrC#cPr,kXnEG+ A#t oƟJM7wU'  L.-YBr`7&ND*)ث+-zj)Y¿aIʳƳ>I t;mࢁC]Jsҍ.t+*o]EVigg~ffS\ WN Rz.N6 akv<"x.KF^4L\;BoE5*һS{| (Evx|%aG|d"Ze}C>dCfR%##EH'qf_x Kq;}x:/1P.g-wfo9g<*M) Tcqe*lȺzt7sya}jKЧIp=7_)3?bWi. U: y[ v}hL$o^"F5z -ZC_tz9=rMSdR;td]+@ed//l\@0K H+08@CTʺF0˻\;_˭itY]3*cWaKh } 钌Pd*ӴkND!ѐ2iG\!M(UYR1OsRǯ t)ܐ4MeBcu>T Sg&pcW:ݢPzc&DүuTݜ:5y.xO_΄ ,/vC[2 ]xrri^sZ85F荏 bMeRj9A@I@;8y*E?8nk=}[oQe3,1͈SJJZ0HP.6X$2%tA*N*= TB Iu$lr-nZ./4\\̆C =+24X6jBp:ώvXm u3R!K$,I gPZJԲXJuÑȣ,^!򸚊r` eZy6c)@jO] -I/>JĤ2p}.w`6]IW@]xYcFxg?AOGs }P,S4C{ȕڴD6{%r3Mt. U;X =W?A1b$;XCz;ŘCj@bMKIu= ܆un ܪ©?)luk>}/G1$6-T*@O2lB @{5;XVa4;]AnB*yYEPs_R'PZR2z>df SkazHFX4.4 8Y1Fx%z&:zVz<@WWcEkdd9 > fFm˜nv#fr)h+oXn'N E1r{]n+ۼX(t 2u&;> EnB51U3i-"S9W fdܥ&JI8n W*,1#E<*Nk- a?*Jg=tDF[;Ƹk5|eG@XG %}PQmۃm.K|@Z#Bb$ .rZ O5t5A^'ai2E`V7I..gTN y';?]~kUu V3wJcv#D.igzc/^}]/QvbPvu RCF}2))Dp{vjl3rv!A 8^~ߟϒ㹗͠{Եx|. 8єmhRJ*eT< H|`C`PR<_[] RQz>"X}FcH7ofE f ݭ}gӐYwuɹrP<jƄB۲1g';@>5X+&„V]_-Vh ?@^%$+)n` 4}۔HZ~ӫƒPq=y \+2e<{[1=`h˭bBbNU4;!D.lFMz)X<^ZC! 8Ro!z<I&=N"_TdouFfb{֬.cNiss6EՀ*aCܭlb!@pӆp0MLGAd0,r5Ao %F S*sG]CTgPT'S!hfpG܃0QRf$nYwD ;Td0; p&i&jh:!PdQocgXǐzHv]gD,Bu xPMBź5ITPN M%PiﲻUKd`‰sg}WQ$=_HXCnK1ibo X9^Ҙ ̭+/QQ(TQ5O&]ۘyg-A饿ˣk&So!<S?UhNX[ 4=ug1@oR:oglz29L64)~QB.wR"F-.9ẉΜ . hȼ&¨] "b+YԥaeY7njgO+oF2fB<[, -xߧWN E8x(Ъ_ybG2͒ggHt^4zM|,ykLp󑥡g۸299>$bP)_xTځn=`90lL:HfiD.3J9SD hj'3[j+[`ѷq_ 1Yfƪ+ dA/Px[L2IR$}jnt ?4<֤u}LTSe&P(u3(S#Ă%F z v @bfdű/K24Sy{LÉMݗX |*¹kM:ㅲiT4{gWӍd:`=0r>tL:?@:}pZ =lSfyȌ xiaA*BVӔ|c3{ &iVA1w8dGoBJxRb;K`]`OM9+ХTQtBaƴqVıNu"Ev<ߋ[4T+ɝjIڪUj}Ǎ拄Y☃rdҼ|XEpbސePos$xzȇ^uXriĺNpwyp+_MmjѪb?#34{##pBurZe9%H: >%XJ$HaY΅-}Gdʛ٢͔lI N9jlf =5;ٞ>+o6>_ӓƏ3LӻLmU2KZ;W֚rMktYa)Q8xl3QƤ^5<^u P nLB:ol#:f)\Ⱦg\q_'ޣ3w-lV v*{S:u3}l-?F7KK$H8Vܠo k'GG0 [Oos7|-W}--FhNFMBjz|f& Zcf 1yԳG &fqzrL|H3ҊU!;`>}hX$< :ിCtͨAJ;>џъNmP_ierK%(zNcsT=RF*EIB$nob_2Eӝ}9EY J\⃘c.o壁Xi-|i$FpufaIr%|G]8\p\5#B{ךPBQ?#BxC?2x>X]5ڻ._>3KFB*Ҧ,U8&'k"lYQcV]ȧP\IJf1̼WUԨRjsJ7O$J+"G^}>lX>Zl᮲VsPs_}? ]hޫ}ηL"vofQ"zcy)}sMt$,Ie^rkjr߿t1AЯŕl7[l p #x7K QiLDzⳊn 6~\U77dnT, KwB(+\Ò!E7f]poH?1d .dFjM65qn yYSiQkd{Et˙= yjbSw\`pmg=NZbRܡ]'?1<< g=V,|YHj ;2k+Nt["7(*2^ϹI#?T\_Cx HluLs~[zn1[6ù,}jz38L$k\EI1ڠYCr|B*DljLtTD$-,g?,^}F=;!697|:*t A-#Z~k k @ˢl$E# }j؟ϴU1Gv T^z6ږS5_ѿ l7VVNd<b)!R:cVS~hkqB&%~wBۑ!D ǏW]}&iV{/IQ:PpՃ1{AsJ7?JY6m=)1C˥Fpc`s+X^DV `C)YQ,cX7Miq_I LJvaꈈ, 1!w;0K$Z`h?xZ_]0^Q ɫ|Z~}:xsqz}^;VFAS~D3&:KqӖewB&_YksSʆ {:$D,&pb#lp+6mIJg0QrXy\ֻq[ܳDu< nE7œQ-dkijh`q-6'(;;]3ackh+׻۩k" %qޗ7!MJwUCx A=4G yw5k7tǷ:LP,FbKlj4:L2(a3$b`EN"_^Y ϙ7\kɴ2&(4ўyC?=?:TЎ+ܞЕ pq%a" 4*t4(??2l}VuI4(Xz?%.43k9 3)HJvڼMߢtS6=<pF g*"%:n-dOel7y,>Ҩovs\!Bl^K Հ\%dHJ3+#?:U@oW(kuix;us-N_:iS!Kr.x QDRZi*Q'%?l{8$Y 3"],E"ϳ"[E+^%@kc>Yӯ<.t)ZTy9_pO1X3PVr+/c HKP]PӨ j:-8`1m`=-YNE W?4@c޾p~e\mNJ dx3e_d_Yg4䣩Q5׳FjVZw!P0)?2  ԛBx\R2#]1G%zF? 7]Lv>x9^ xd+T8ب!A+[4gTM r)}\H+"N;4B0A90T|4:L-D2W'PV?x\~Ս{[9$إFC;tozY2Ϥ$;׸3'ux,˱s۲q.e&gkqxn(T /ܚ2Ba y%U")its[F{cn d-ꊓ{ Ռh\)ԗQuW$x:Ӝ~Y Ì6\he/ٲCBG*xDbLi8ϫ$!"@\o9MjFl#2)iu&,Eo/9Os? ͍5$L?\q75aտ !yv \d-ڬ WSԟkxZ,6K|3n 幥VQRݵ╉]#8,I`*؝/nkT5ޘM=,־-Ʌ}b{nr&u66aT ^!1RԻu4/ WpC80'kSq *TP6B~ %DJf'^`$9D O$f~2RrAVְ|3:kJ>o̖q5VZwl( YkqQ{}zJ( Q磣-BoONiwGlOm.s̅Px ~OS~?Ly:s҇bָJVOW=/|YqBKnB`3'[r]WXMSJ "nKq]q3fMy_G44Errɇ3ܘ ]%rq)V[Vy^x"\u:kl% 8jd>)s5dk|vCq0ᖻ*{) H* ƄG7/Ygk\e?AYuP?/Hx-*0 (iV5^3 sgO^J¼m3ND~#`No\.ޛ (EЄhDӏE 6Kl>ꈙt-ŬDҵ 3+޽{`!MM1b$ڌ7<)Y1ӑ~~XyNOV¼nuM%  &]= NJ۔1Ltݦ;Δ0 }uɼk0c5k-W_%(\@t׻ί7-k_6i)C+JZrhTsI^K $L"7N,2^ μQrW{fIYmU#:>3$H1U=\T~ro2/$TtCV>k37CP8Tal9Ŗ[ ]c^vwkk!zI.;\VqMP2ڣv~Cxr cYVm+F\ӠЖPeh`,O"pCr6>d5R?=j"@-XR{Ma n+A~ӳ</ g%c@‰ ]KE+uNA>c^-" '8q3Sh)AYlއGt/G _oI}jn>KJ4O+'|2J{5#˜$k6*ЙD ZӇ72 ǎo=p},jHOif.bݡ=>O3Gp|}{B̤(SW=駔b[,lIhSzqvi>,22,uro;D:b1>Oa1P_濆Hdz2]z0J7W)=)l#kɾuSbk[̣"ҽ2BQ;X+$[ΨLݝ%>|mx%$${օV:(I, Ӵnv2r_3_p_[Y[aqҶ9$z?y器wؚ1@`λQW,敡?4+8o1sRX Ǎg'TV)`{zEt]eg#qJd& Cq(%=c+.c`4Z ieF{%.*uqLuiG2 @&^zܲfCm24=\ozwMyuUtmo[2@6b Ⱥ;&k/;kG8I(YZγ1gnJHqÍt.5XWEA HU9?G H }[Rp,Doa_K;6Tx";K?IVJ/4΄Ij78({ZY~ͫ~BM@om9jS% ;/]Uz9~p QV5;o >qCSfվ`ߞ40# -@ґIm& ڷF[)bo^*o hg'jDrp)z4IdCBUS A&3p3=LCҍ?*T.7 ;jX6wQĞtG+ŋ?N:k\@S׸Fا +/wtGe`N9?Nדqo)SتP/-;j_X7cX|^ȹ![&|0UV=6c3lZXi՘ӭu_hG nF[|Y5h?>^4s סFAqIĠm/cln0=y'jdRe|ieyi( F;At6/ e'ݝF?`+]N2N^ZK.U[Q >η` DE^_A31e5W(x`?r;&2O7;T427bW|}*[YT)"P< %k(bK~IGbWcAӚ{Xq4_'sTwayօZCpbj؎z-d8޹)y+`>#w_DIv!L"ðvʍos)},.ldd&JYag/F`$f_Յy.㑱Ӳ >_nCg34;%U$$ĥ!t)Zm t?{kDNwf :t T8g<sEpFE?`{`5t=/K0Bvzo$V49rŜeU<Ϫ0tȹԾ93,Qe,\][ K6ƜIt%8cT+?WA5;&-mzN<)K#QOX pP e=7DjBؠFHT?FsB%/t.Avդ񱹡i2/$ifGá}vB(}>+*_QcP" Z5X&il$9Nx&u^BHo%LZ 84Uop`2empw~̛bw<ᑾH`̳F4bXrD[;Maո2u JinGTPuǝotٓbP )iv2ADObV aoD,`F-^`W͑<{  \֭=XUy&HE%̀x{d},L>m}6MtǦKD%z@ukD8B7;UtSPA"\5Q%5aO4aaO+#;g>ot9y75CstK"עB(1'V=4̍擬~vӖ,$Pض~Ȑ()BaydMjvMUOPjt軝ƿz+ݠgJTH~+/)gǵ捩۩#"iɧNp;MUot#doGhq?Ǽct>Xf6gvYk @Kz߄P6Q|;KlPuz#X*)=y{1ީRLU/F7bj˓YȹIު3GG."w#Cݛgf=Gj/j6`tqP:M)|U 5nvv|o'+ԙ>(Iĺcbc*UU^7ب÷VWP4;Jlғ^o(؇ቀy BY6{~$fr PE=K+e p.0X^K`~Ne6Jb\?lz ,<~S=È⣆v>D\DUzr0Y^hJf0_hnm h@Ww'+t{G/ h/e 2*$פ&ooN<9t5Er\|٪ Ӕ xM#֋d2_ QS.*_wBL7"9S9,%oP R >{C GִpS\dYYpb) GVh+*h;E+CO]لe Y6T]3"4ŎqPƏy(Gi)dqe'{B|TvreM=uh/xH Sp l9D5N`LM;J?wpD~0:ZsǻRVJj'CJP ]1ą  'Goid?CB$YEcDLiu崂~1^qWY_fp%/d@ Dc{y(R k ( =f79v, *\cLI-oГXDy6f4UT"gmƢ IXA[`!Gp2*SZ͡?yH N;)<#s2 q1:_IWv),BAe^>tPW0BۥMwPQ 8w9`LToe htwu(xpjԠR%v.U x)H?;=~/ }c3yS]}( ۵e}Iސ\"c&!TBj.4>tjxp&`Fcu #>.ȡWE(r4SI݇JMY+4ߡ|>f[;%:f oI[LQ5ֻon}Xhs} b@4Gs)ZE9NCa8G* a'ܢlX1.ypIftI-3ܢ_:[/(e8 ^L7˴j(ZT\p;3X[sh=jҨlЩx" 2=")wS4,wufF Z06 /n3ґ:̦mv75f W7T:/Zvmޜ>g:77OhOͯvaeo^LEUJ 4L 7"DaEp隻ZGҿ@T vI./iSBAYs@˞ #}O>b=92aٕ*6Д NXbULJ~|d[f)"w6L vؘuɑ6D$lDʗmi~a><:ŇHQPnQ8 \ui?.nGo}`a)xAwww0 !V3qKuR%.=|F[X+`{_ c4Scrn&(aC{H$h"Lr _Wh!mdD&nh71CQ՞z^ ۺi; ʎ$G[RQZ왪)B A=9lCi| ށ{ adluEV`ݕ}dOtsQAmZ VCjO EC{t6s]an; OYmrU?[oi%2cr!d7=[\k~ D vprOb] |I.vS<"l@!ZQJJi( rXם6_~[[OwG:< ̂mSeGC+,0.-ڕi@2# )=䂉Im fh zq.imWFI Q{,4~l3'iDs~ Qï(^8aEXB6tc5SWEMCHI_9E@zyPm$wCsT 0dxTQ6Ӥ+=T3ddg.|Bܛ7vQk|tH2W6鎛^o'tM Ps,ր9F^lbEr1SǷ,U`{؍RAG 䔘ɜM{bEc | ͊T?u_vBTڝVUC 0!٭]շWOƢvn\=]ٞ_זv3:V ;EO&W?\9{l37JDmZ8ѽ^I>ur SV%Mw+ \w!s,ڼ/$$& ꎫѾG[~HEg }V wSѨ0,kR'Jq:[f\KӇτEeGˑeoBְY wa֚Xz;7xnv魖15} ps.…~@Vԯ:}Ԣ*Vay WtZnH*hKPvXU=+6l:^s| 鈄LV~p?[P?=O wc Վbw^Oo/( QDWEĘ|iOEe}N~Z<}]{LD|)ΚuP;)049Lh[,a <Ĉ5Ͽs|5IYKjjgۆ-R}:(:Mߴ Sv3Yu8ܪH­TG%"+\GQ9oW4NkEF.qtﯔ~XTKoK?^uǶu)T8 52 `2BnqOE@%q0*C|rNJqYt4-DjB?b&ae&IwkY 箌aĞu]ϼ.e^ L bcBlnY8Xp穝Ijd(t'mϳ^C9{ZԦ,mׇ3=9ǹ/32hDڑ 4ܦ0X 1.lj[x: T|1Ҡ~j8P2<^*w֥t0t E1Nܪ>PloWv(ElAI1+tڢ}~?)^>ۤjI ugs2 ̦; i4d~?;WkaCl}03 (v]xދ )˂m˖?zZߏ|W6 VDtvDp?:JNvM(S19\ $ :ZZKR͋@ GOhtz{qvHV : 3t^VR3׼5=p8ȸd$(fQ uVPU „a5/N13E?f`7#eR2\)0~atK A$U3EZ'.z[0)Z 8 95n wLs'ohȞ^駤(>uYʍ' ג6Lc`ֵz(qkZ5 x(2@zs>q \ !cE4؁MÏO̩r"'`TZ[Y|Dևy'\Wkp<5lx:9og\A#\Ü+5&Ll)r!?4QSp? *f|WՋR:@/#ǻB'(/sXvvڼ!lG3Eх6d v{)zgBk.a8yVVY,:%:տV4b\0MW)7ڭkhLC[\z}nuz$Qqj8pnjNݍdz3^]@bt[W)tU"-3IgH>3hrk4bX˖ը^6{u)šTO/ҡzГs޶z+Ԙ /J_5tJ_b6M ŵ W=2kmZhPgvN3yjDՍ;lBڢNt+ϐ85al"[RK7c~יq;T"ў=SɥL lNoIQjR`(>E96a~Yy4ȳe'I샜m]rzKdLxgr(Rn;C O3aC][>hKA%O]Z-3n*`$} /B9뫦9?}@MX$A3L減`g,@y{F}y> Y~fyZYe1Eb&w/֗ h-Ux_y6Šd92paLa-JӍ_׋#Xo_&n󏸎,KQ"!-+>WwYF}`gң~uZ|N`oXʵR$gG$WM4t;J ;dkn Rlչ،ᶀ.Fc]Tvs>,n_Q9XKԅic@Eaអ-sv"4|*|\ F#miH^!4wRfkh!+m9nPȄ"ܗU9j-7SR<0z*eP6UV|ż7-c/~ {!kXsBϐtNqb䖨* [ +d& ׅuI;2.\m7t_t" Ai t\.[t.YW#wCnМf}Us#S gCx-FX>s-nO5<(GZɑn ii|qBjeNliHkyt4i;9ۆB~<0vBW/y\J: Խ%Ed][~0pj]7`52p3$(^7H@e&+o+OLuwtD6C}'|{SC9EH}P>sY$D*^v-Qv}w RѧW[ 1#)%vv{?*S%X{Bl]K3d.W Z_{:3xnWyBA|>YbHɵgS.^eR@s;;0] d>vRRRwn^zwָRQ ؒ<mP-|NA#u<Ϲ%Φ9O5r1_)'(=&&s)!_:VC\]tG?Tbp{4;sӏu^/E9)d?;1NmBS)04N~-v֑&P:"Wb/(->% |+ӓjwvj2b"Xx0Ga \SE&k0y?=l.+3{zj&|FenHel*u*ZYt\ ,Y;]o2\`GZ'n9ٲ;$6cXQvmU҅?AG[Oҭ͈7 ;yfHI&RYTXɎEԜߒXY~:t#aPGa(^$t)-'AwPcQ, /Ơar7wX&=a }F#LX f3Ǫ6,7 kJ~s/d.۫٭[?xŪU5 =%`=L`/[ utBGmiv瘵&s g߿W;z@Vu~dk7\Q(70snϧCO ɈC5~*EeG4RwDg f7ջmRHٯU /e)='h`9t&PIzLD/Qs3Μ,,\J}/fcjJĿ8-?тko ì7٬;DKTl>Ӥ#@uU6#JA )'f{ߖ8#W dNsLW%uț8I1x1_8 =)Dj-<ǫ(Z5,m^דSVb;T=cNohq~-kr MعEbX퇤D sI-)YERlo2qK՚CO&)QMz!t*}DuBDn^OWkITJ"Z mb TYb):hMnW#}~f=h#~| 9q2;,Y׭En̾/u6&ퟓgh#]o5jzz#Nuh&fN:YPIy|u)0mfm`fqf' 1l1 .L-K"ռjoaU*Bz Lxʶ~w w_-``Ғ+aIA[,knu+@zF&x`i Jև޷ɼˉXسQ핱(pY=AlU ҔqK~j_쎁XxXV R|A$"Rs?4Lk8A7"/SPLͨNMed qELh/!1W"yYX[Au1kvr$q|Y<plC]|҂]UޡXpIo$ 9rg$A보yۢ:z3Z U»3Xl YD,#DHu`\Wgk3}VN2 q8N-~fI Ѩ+jɖ5Ö{n]FZCH?*0獑G\=5 h@I3w[_ AԻ@! eOLM~UsLZWkL\S 16#+A#=ajJ\e`H8Լlʜ6CӹuS+Ys5M+#";]$4[hx ѧثRڙ!S>|Sxp' IR?dʪՏ+yEek*n1XPFъo[ Y_>B曬>Z1\Fސ#X22 9kd6Љ,bOT3zK5WBmpgykY}!3@hQHsQxm٫bT˹~6{WnuVTxbjw|f8NŽ}%KH=`-A Ja+;Q]bo8O w7`%xlV۷IKOev)L I @/kߪ̻ ϕH^Y${Y&BQg{ӷ,0F~8.{Bg p?l1c C FcL1XkzK&y4x,W_Znœ1쀃/='l7oM$Ɖ`5?(XXk 'Eh]f0"lÍ_C2|ԗ/UNu988?1sLdK=V8W6UӬG Ȑ.XF0i >R.JKLfKϼ9K 2(s{қqe|ȏ'!2kǽ3T'}zQ&G)Ht}^~p ѫq|'>5JƵRz0uwM q%7˴kd&櫪zGj pDo$^a*m@4 wSLܒ0ߊ[TU: wND{DZwJvPbzB]뼢Ifе]kQSuĝ=uæ?a-uܯ{{7w1Kו?b]!2) DO)-\2#-5# S;aB77R._F.ǀ̜k!+!LEq1o;e+hGLf"G@mI/3PCM*l#_kQlGz= D:=e򿏖+Af%/Ӛ|_V-, }xٖؑ^9|DXۚ>D`swřU-{aMt5)N4W 3\|pcC'5ueTx3b|"2.˽g'H̛vTr_ []oKEu8EO&K B}l|[~_'u@f=/a+ T W%ab }k9pjiX3{yLK?HӖv"n.7G HUʳiP Y~7mmv_8X3j¼2ԛWV$k7Nmnlt:"R>;KYzP#ICAEwj)P._l2;f'dGg+8=QmZAkFRA3ZALB ^4}1JB$A@3U/-n]B^ eAC*OѦT'˳ZQnɿUtq#np鰰$~oT=/ H7Zڕ'oS[QHYz 0ژ.RV9դH,!(!2€,BaR0؛V7 *K%xʆo(ꪉ!0PN9W lA*Ig# fq}!3d)OG>g01YȔ o(cy%D:[ XԅyQB,uslX|u!w )6-ŇP+GrU¸E ǟЋ+/kJX%%`}ڊ@0tmj. v96Xv@<ҏ{}™ݕy{u Wbi~LL70K9bB0PlЎ??rO9~G/xHHa| !ipC9nS69,wS>9_]nuB8 6jx;}َ/衴0F# B;ėm+=hLHc/h]%guv솽*nL?xX+p 1 IyWT.9bߐ 8RH,؆s^\tu?i|p[;SKh:lx9t&Q?xQ狑>.ŰX*q%‡ƹlw^?&t=>0 xqFoeΔ+ygF1CM6;)ɣwŒPv)@Ch:JȀB;c*d\uNCYYT"BQ"i\B~ Vh}1RZC`އR5HJ3pčzևMՁ"XĐbbֻʉ=sN&*#ϾՃ`ݤ#fXbmS%LN<(P=X,$B= hop&gb!N>4>m|Y+!İLݐX C)϶'}5r!:|,S?i1D"GV9Fx/4R愫 豴)JV.#ۛwh rrɦ%B!ؾr `X:Tb=f!4_[?"Æ % Sxɺ,PzDk dPpCx9,&ݫr*ʚ0{t#jDŽg\TX!Lexikbk|yOhKE=q"uNv,نJbHHP5k=vP$~zj-R2)]qki *W {NSć,_D ̌bg8H!+ZO')Eݱi4XgE}Pp =hoXH^pg#+(n:vsYT9'yP`FB9q{ŋ`T!p6lKRGP!ț<s&| Fҳ g؅ #𭘭{wM h!HJZ±$B%ƪLLN k9zGC(q W_\oŢ&&|hX6i h LrZt)jsVb%1bswx;9o (`ۚa"}r1igfXTcOf ]q&j3u] 4SQf\RECs8`>[աI %^0<ܸb&{߇(Ť)0Si0dG; ]P. 7$\X(k䌎nv=&B/$q)&[t,^{CLJ!XH 1Ef>fҝ4g7W%An*6>b4v^Oe6޺.;C5weK-t) غ.Uwp A{z8W=dO8XC5wooW$z~㛬 B+BJwڂPA0W<g36im* 40< mZ`2Jg:>U XO(GԌ[ G&F +G«ME6}׉ f=qT"u77I<~| z4F*·E⵹4PU.Z߶BZxp5UV!ro*sOxx/?ڙvMp8 )JZV543$*/}8@z:Ʊwu̍.Ce!iO 0c[Jq7ya뱿;(´vEOnB?<ׄᚁkamV*I, JHх F*Q72?kp( 3ܻ< }'If+m W8) kT׿0O4(B-vq_$2<:uuݧizr=3$PSɞ/Ug *6.7?4 ?|xw]Je=: ~C?ӁWmqiüx;LoiٗUZkoΆƪfE7כ7p֝eJ/_=?%2OȆߒtOb? Ɓ (e~ kҺşՕ/5OIXAvKsG>z$N6ǻE ڦ=jqC4&f[;z[X-La^BY s[ExTdCCvW%|y}A jgCmT¾9u\>,Wr(kqek %S2|2P 9<Ƽvñ?Yn5b`^ C2(~=4#mP, ~oG3>7_ l :NݔdhpUV U}^4մFj'@߉3٫OCjOʆ.!ףwO~Z5M#>-%~4>ԟd2z㰮h(d ?7U: fuV# )b%j%l씏DhCl" @QdҊf.0YQkI9ߡ<,G%h-pJE\舋?ۜ/p ;,54)Uo]`}G"FyIB.|s4AZ+M}*uUO<,B9+@י_n*+g'S9ۥ*LDPa eI2Q<<5q-):1t W7]J5Ejp{s&gc‹@^SN*֕cft[hY/6Δ"WV^pNs;DjKGvUC^<57L[IbϤX  >#N(Wh}s.>)eOCڤ^`olxie @#*r"qiҴ&Xޓ30 M7RFA*jL cT&tZ5h=̱Rҳ~;祈~[h7QxB q@qY=WFj5Yu9J.|PD5#,^A{>&9ĕڞyȣ14ihIG4EtZ$NƘOi#>WsYɆZ9X`"b*HԖ:s"AHۍ[<ƢiM|Ib!XwM}m>Y8m@v?| ?!VOvGɺfBi]!#=,FE Ɠa{"2,J8|⣯Ls9…hm͕wF^ :%Bb{532I܀Ѱզ^)1xi? )>Ӫ0aŊ1h>u| El[[h=u*}y{ $L k'݀O}~-ɌB䆐[BRV]ΌTC)ƐX^+]ްnb ģSzzH ~"̘&ZMAqB2h2cN\ mp򧥪̍;q!P'xCY4>df'4R괻uc%b̞M-stIGcFU~{:ka7jM.O; hl=[Ilcj7Yfmɞp ӱ|H# K&Uv1KM=2"~M,ΰ2{9n5$auMrClMza^^g@pTH搎Vj] IUZc\6uSZNA YZ/96[7d"b$vV^Tf!`2r|t(zUmmˈm"]2^P| Xs[z]!LyBwd/hQ(LrWb!]}k"6k'Jakb(ļ[jT#Py TV' ܘU#Ԍ YU2'S8S[ʟBӓg!ע89XM5C$|=Pϊ;(ǐ8?tf6'{t(\Olޱw Bm[w) J߰&aa^;KxW6ʕ[z}mOY¶IBؕ_&a OYUI9u I}+'I䢌Dsk: 1"xk`pe 1+~m ˢX0@j)&讖&c \ϩR};&v)0Oo$Ʊ/hNngg~o",Vx p-[4~])ZU}d SnVaw]WT4XU/D˦ 2,D ~?wh0ye)Sq#f]NY{lkN%s/9qJ'>{ r=R6.44=S io}-+6Wةj'V@MjKV!Td$wF~G&2WBJk`?#3"J&h&AUrt;Ɣ K4b?iXĶthǃ6B\S)~ԅʕf X3cb;BZ,3WM 3)L*TR`R PRΣމy},Zr3Nl~֒jUIw:'=\Ia`:vi`yԷnT!G%ϙΧBhO҈a 發<Y@rhkcnd0U1=veз wojoa!o* zT~ntK݅[oN/K!㐸 kEdapJ9xS[qDeaA%+:*wcKDgQv%c[r|S2ǁC |Ud@@-]I8  _o.[z?DU~6T8?I!뾇[ySʱQf"M]0Qj3&2-jehF,bfL6:dm@i1qw]XR/ r3!5>k;ތ{mCrnDORS2%rö0N`S$u-u/Y1BU3jUC.[EG4hYcVѿy2Q# )S惪 7%5*)#%X!)1>cƅPzvi}xb$akLC\j!.=lTouI M~~Z%3g@qBtºG;üoc\ch4B}'+gW3|MgoN_\>0͆-T&Vv`߅ JC06BVkĈHQ2%2 n_]ja6*8?R<#vm3l;T]GÑH~# KC?@ `L #bGy(5;5"ߵ\_9czY<¡4$R 8.i%$TE2!lcJ"GDPYS\WX/dj )m!4^x^EA=S\7P=Y&+ қACzeE3PW-ZOy),ցhY $@WΥ-ptsoی]d0xk;dp 9USGCc1;P^SorU^ȨpDibAX~:˭ n/\66wwVpv]n ?Λv&;E)mCՐKN!aDS2Z٦;* N8rp^45(nf/ :UЈ@@|XSCTQN)_ˣbW5 ߔ19O0 ( {vEZ)`OU pi:I ` 74IIYCHx#2W}~3m\oo#a?P2w44f 9>ݽ!X]{;C gb3ۗ`F8^_tڑ>8s=V|7phqJbk}7uβ3!|?J#iYitn4Bap=w*ӷ_6WV-aq?mV܃0'*3r$aV{d5% WUpCp}eUwVI&M/`pIeM͍*[up䅦dNjk6NĘ8WO*}/9[[/Co1 ?ޟqV}?c6{&RutӶ\88!9*q YP,5*e4( K z{J]!%K  ۀdRnd{_'=(,1oѱ:xGDKGXN Cň=oRja(sIkSԻi.-#S ųQTwlA:1֮]!,{V=@o~s1bg Vxz!t%r%2d[ Z\Ȕ]9hI-g(_cuuZ!h)_鳐첦 cS䵭S}0TPovk4:VTQC>Եh6tJɎ^ ¬܏3JG|]☮X}hХY.h}gQէΔ4L*.-һl@4 |o VPC.eE7w RY(zz?595tj[Y^q [=M7H!/Öpvૺwl_&ڗNDhEY4O:HEƪ 4EL"bwz׶k~XҸ+8$zQٞ!Hµ< elay/D񫞌8mJK'fʐ2IgwIa4k Au>SIB7"DZ@Yr_dYm<1$J"gP? 9B6P:ZrɄ`2{GZ4O"ymRIA^z5 AAheDn myLb86)"<7g[-\*̗Ȟ.:|Waik-V.}֪F= w5W? 5vICJi"(r(§4DWؓc W lLۉEOH-w x%gm9,~`ܤ+|IϔtmKt>E`fG)QbfCx$G OG%s{NM~2l䒠=mgqgpV:,3"u0#PqV*j1JQ:⺲]6bbZ*r:*.ѴM!8ϭ0^**.:c@$(.7TotN۞tFi,HiNcC̐J)1dαt!_M4!lm8n,5*R":#Gü :c]Mxn 0._P޷RqP9?8˜(,OȑA*V򪶑&S[נ8~ Jw]FPjjq[sdBSKK 1xd.5u&V(tz~2 `3x:ݟ`كt`=h*a-֣8ʧ:!;5!/%B.G #=#]`Aߎ vDUÓ,,ю4KŔ+_TtGJ_}_xa!qfx!  r_c1BwʷY+pt‚ؠ! G -Ж:E<)jAydǻvi:ȖؕgzyسxIe"hS/3@FqaP3;Tx H#&#*RJ> zy0\bΙr9qO]GJ wm#7,/ Ō8IHqZPl`9mT0a`3.ak9ۓA߉0E| & k7ʮ۩1>϶XL&?VÛ T3a>Y䧢H Y.cNP,[x*Nޣ.*5@a]eLF}D8%-; K ^+qA$#bej։ {hPs'Ӽs%9ԪOqy)SV CY= qZoe5QGzٝB0fXe͠ T- !be xIak0W[ ^EJ4ROj^8=N$a|]rd;U{ \;b8mcO'v֮J˝g{ړ;1ڂe1:?1t5Kq'<~uOr礑(ʍCNcGKBVjמ/u=>.-1վʶᖸ›ou]T6h-Gf} YØo?뇁cb+7lREYӪi.tr WRBKzEL(D܈cGϚ\a{o3HvIGs.:~t c]QP͸>U,' GgYV}nzEDխV4_1?ci}Ǝ@;ʆ6*mZ8ZihP-;3(0Hνh qY"*ӡ=MJ=7JGj{^ESM_:~Cg{kaoS[,G>%b@퐺ʹ@SCi=kȾ(O/ӰhMlBely)JZx#/jȣӔ>NKf1CQCVt- 7 Ɩ1`Q&şr~\# ke Im6f(wtL[AY̖#P* ~.ƿ%oG]8[eu8fW<4RÄHcZsV/|y`U kP[2q/zKyٚ|)0Nz ]HB(;|T.-êfώ=4H8=bTz`DyԜNRq^5/#Xy|ТNi+ 0r@8p8*Mx 64 ֖kŝF0WljB3۲;uwMTf [hxQ x~3X D9z4G?xй H SJH X#[- P_sVODj.ViYf zvRG}h@ٮ\ YaPV Fg\c0H{3 d0p;+y ,3[yfUgd7/Y-M.#'6Jо_)%B-*"Z;>ϞUCxfbrOxE &]ƶ6CWp$_Y&pt(d`dveHɲzVGA"~?$*E?^g{#Zs5 -WfX| 2 xfvIau4.<8 9^u\=UaiL؋V]"# ʵIh3v_ZXG-F) S4&W3`Z𒏶u`ynUhUUV4m/w}1oY&H%3^i~^ C)OD UY<#ɾ S~Ov_q(8Coa(S{7{m=iPdBʜwӎ}%: aرgV$j"mٜd{XEq([BU7(4 %:WWݔ<*C3AGUp6 L]3K"`5Xƭq!YtlPqEk^ڸGݭYJZ<~Z';,d^3bg8ŚЩ]u4Cq ]w^gGh.VP)X Yx P,3@Nl0߻ރ WHܲ*EO{R[xR2IKw$e{%m7P,9Co% ` iDǘ|] _4xA%RYO3B|T/g PUbu z^wxn1#=7J:q}HD:ԩLpkG-e^9|X}zI2W47uQ'8Zq|^[g78ariȘh!zQ~*㧶 3Rb o]e "5iP q[ 'K (Or!mÄʏưeu9zʂ 2(c%R\Qa0G'%bڎ8Mv˱^TvFnA~,v"idaxE'| U:S0#m^=F30$XQ nFA[Yq7daлସ@ڝ$Qc^-쟏"L3?\1jPE zfG* U#1RTqLڎ@,/mGuUGTb¨ 1+c^i%Uq#nn0kIw9'+bVֵ#fCTbtTټm(4_8N"SD8%V38 #:ޙB12 x ey7 ?B[͌/4`ٶkz7w[Ĵ0u!RAt$K phlT iS Rє-*.LG!XYoһ3\(ĝ^( }FY`hhD}GΨC<p! ùȧ%dWbhfkHi$rsPjPgjzpxaf3懣@RWX"t xzcXwP+{UF]u$#aVZgeنιE>WI[FRn[;4C2;J 2wx.8Of`e;rY\9I-W m/v=gU(cLKQp0#W<O^lFiQpJO@{iӷv' #\\K_(\mFrpVYEê/Ef<E6@>Go+jr]9̜E3Ax+@b)9f'O0&Sx-v{y/NPOBb#{:ܮ>١^axpbzm3݆aO.UHv(R\>{$ EqUz6O{d^$E,EbgnC??<'IyzhKwZͷc ߹*J7C3QUonKXg=r;u.Hq}Ο,.SƇ%:4Q*e!s܁%\S'&_yRY 0WZ9_P[c <^(uHE\DM5˚M)7{t&!i/̊B AµNfYkA0kVXMyr?ɱNۍƷ9l9dfΨ28N3ѕ]?# 7 ୦Z"KD픆%]U4(id̓Wy|Y1坫&Idxh Y]sۛ~-i>KP>I(EM'RѬ~ k%qBcFCN` Fxa+lNce?&ܑylukA G>Pg:},&w= o7=9ţW{u}w3N:59.x;f>*| =Ô3#fp<h7Um3jI/`eG9R7<}Ixn8cl(;MO?6B헁+}@o0gk&h˜+vR̳"d`OAM#z6Kb$hua hʵS;HC΢%?HTI]1o3?P}cnooQihXufB\K/̨9xdiJxBwwV[=ݖ!?1c2&LfۙC'p<jAiU53n{{;|+[buBK`8OwSqC!|7)yt20KᗄODzGdQ"tp_v B-{.՝;`#N;E Gɦ6+V- RNsB+$eqCp%3YGH1쎎$?g:Sgmj 9D.|屧F}) y|r<}tԃ+*Q)JTv GXR9&EP?b"p[,ݦz4s2x ql/\ Lk Bqt'P#Ͱ_nIkIWy+嶅k`g[UqLBr4K a'{—isƞ=W 9J1^BJ&8o*۩5"Irk Q3%8~9.'$&(5M,/&q QM~aOԦ[=pd|YfW(7kC^3$府C)?/j ۭP2*`ᒧ@Ӟ(k74K߭.fof(mE讋"V02Q?u"{Fĥ뻊} Z?t 9`yHkA ]{}q5#]Еe=PK 1(G ="ImxG"Z7HsQ} $l:̨h1 &sicҘC1,}v+B>`.ۡN [6f֌pElXt!SjM :÷@:0 ;$6hC#eM2 W̚tSP)m8]y@E\rHGQ9+ ,8(B~G_ tDw+BNVeT:VaWƺ&dja))YW#DjU+,Bz O-sD 2Z32Dlf9\Z'M =K⚀r4UƘ{9dwiuaBVg(kdoȳVRKT VRqbd::!ިb[ay`gZrb[T g{!hP cI2فhvj[%מh؛e2F-w2#Wd-T'ڡiRu+C?9[{ad?%)X6Mb|JwW]tӼ*|JD:KphKi17m'҅f@\dgC")3Ͻ4OcqҲrw"aj$6$7>RWtG*#t^6;>Wzu44'ci;i趻0Y( bOb {0--0&Q!yMpDnj%sb@~kLSg9^M@0se0vYp}=Ϊ}a!^Z%DmIq[eR,ǝd@\" tpl_ߥ` @H\"4eM$_9tfs̢xXBq&a {eq{H Y _|Idcףc#y/h?5÷R=zKQ{ ˙և=lIDD[1CoFdz#l:uѮ]aw 2Y UV2p%%E$RXb="- tTTGoQ\MUf>C44V͘AjpJV"ι~CU?Y~3X3TЭ-tBX9~~*gNg4mQڅg y){gVX \ԘG**y˒댱d33V<9W8ȝp 7JQҔoG[֢F1$UzqQjV ؤ5C=*_Fz(UBc#%bSp`hxB~2ߝ#K,;wm8v->=u\-^<6У$̫50boPL#Qj´3n![:,[RU|+>FfHj{.DB// oYX LImF}QkukT;H려;'V>,4`TPY ̸%<}8$W^*a7ߑ! Nѓ[+u!WY}K o)1kGLO*qHjC+#ۃV9(ɰևNӓ7D!_ɖG݊;HѴ+iO`ǏyoR}`'l}/ZMUa%E Z9lͰ ePrŞ䆍\+1IyJ^XLyeL_׎ %"|S6K{ gD7QbSAܖmL|3øͺ,QfIS21\O'o ]0ƚncOZyrأӖ3㜝\`^}Ur|y2N%DoЯ RswfUSUTj %dmzT4,P=ݴ{ QVSYO='dl>ELL yoȽ^I[sҀogas'?:!SG*,"Np3/\+X~MiPK v\ '|U>G}$Y~g}/- J ܏} oZOQJ~5@CѾ'Cw"R}] u7{uFx΂;YB@#1Me9,PWhvU9of.I%qA0YoȮCfl97xT3 ]^B& <9bA tbیxTŮ;&FȠRloA0CG˪IQzxrj ѧE&҃cD~4oEOqHneT[w7Ђv1%!NfJ5!7gayVDЮ.o$4Ǚ+=yܻQZ/rL<ڟLfͰL5,'-W +Cg/!S,B&a&dP$rYR5axE/]94K6/PW{wӘ*ƛZx11iTR3T)cA';5IѬ.$kqH^jmėIu^5D~vO~23o 7W*f2s}V[tEQhOif&R>^RF8\0j߯qH mjzB'joS.Kru6?8jgFu?)~:K 'KaM(UKk{¸,]g)zJTFG1d Kq5H:iO,h7=/Tǰej'\ZJٟ̜ 0:s!DC*n[ C^]DVˮp;(^>k"Bj!{iP[?cUb:V2L߭]QjΌg#V+!,;m謁),΅&>Lb+Ā%ٶ͇\[DcNc\X. r,X׉ꀨUNM?+Dz=IBK b .s93 YYHnCUi\5]Y<:qiGmU Ps.ljPm0QaO$ET4\>4RSaݣ%Q(L:X?QHN-^kHqTLW"JQǙ-,a'h &Y?7XIVj1hodJ\7FeYW;j]LOw;? mJo2*:+oW$GC7B<1[E@Ұb@7X]sU_1:V<;E}df*$X<Ey|[%^,]y+i]:pHfByt*W2sHiM0Gɚ] Yy}הxBev1p ujcKa̯<~vn+`G몭Ȑ _h&];D/󓐐0_ޅACc@fYi&07u5&pk-*aU\~奊P<^ש {\Gj8YNIR?0Y Cu[m_͐I8l?m )̒5αwWp_hC *ߐT&C#>>MeV#`}X iC$YI=JKH< =9ROBQb)a =iI' %V?3"RIݨ* E9`gC\͂9cXU̙b>f?FTm)Y_g;~QOb(C P,"xBRf@`ǿCIIk Þl5xw:U,Dp[5z<" R\蘖Z0[52I7ܘLP.q OFiArg;zN[T|Uʰ 8OO+iNjI8?ye^WڀS>t2nVդX@V?e0^l\oƻ& Vfë>\QnePc?"["v>b)hgdI@*n BdtA"VV+u&$\Orw`ubxJ`Af +MgR)vII96(8o 9>M،+(>`8ͼ>B)";RnQ 3 .~insW'K]u2Wlv#PinxRaT@V pX"7'hիs4Y\|KpexloKCAdJnF.mI",RLp\1 \n ne_Wu?*LGJ`䍤F-SbZŸJC(/0;eˉUڠJI;@j~տUJ}7,E2ܼ ە5uF6q&Q(7-LmxnM#cyq?E okݯxku. -oNJAO)H.{곯YRpo/o4 T1Ja[Qy:nA;#9 +%Ő=ν R3vR/4 kE7r؏O=KYa?[#8ZH=>H7XS /hxTϛ LꓽXk2SQM 1tY2~;xR͎LTZ8 "ݔw1q ry~Qēecwy_v= I<l"yDF *M &|qūWfosKw[~nv풭|r^yL!WR,!e-,2<\p}0iB>Ϛ@yzڞD;9 [X}a-9";!G+[Йh$2T[ID_q0r閜 "llA;uBm;߫Ō5zX4Z%.7dβ^fWM1oɔ\gzOe +aI ‡ŰΔ=eڳEHe*- ^ԎE?RTQǀ9Xƞ_wRD5Spg4c/ApK-}׶0FKqavKh`i磃kq^G{l$2B \MCئ]2=-OMMuRϑ`˷OhY.b"r#$ Rp޵)!}_nWcmp }vP7b7gɰQC E+jG>L0Ed.#{99JOLU) [hD1h5q 1ޯyFʭXljmqfyl_0Ց$ Fp\#h;3O WmΡ&K'VJ$Hz?دa}hvA+U Xs1(H!Ƙv4/+o)!b?ݽ'guY"qi^g++F|(?Vz1D >oi!n}c\-L53Kz.bA*nF<t h(l0X-̓qa0`9:yZ(mi,P"51`K -O0+VI:tG2+K%O8' |pe )ZAVY#/\{fraGj kI\NFq5&ϒ}gvoDZme\Mqb? {G>m]aSgi0 #\1pj>s d]x=9la1W} (;˶S4Ʀvݿ ]ŊYIJ1hf3tlEcʸ\hoſz<z/ (X|5T@ņk,r1;Զ1V5G[-nN#8d7 F"Z eqE}UXy1xig<6MؖiȊ'BdKUy73ܒ仆Pk-Yu3Ү2`G`?YkuVVf"(y#> &4!6%k=5B ńU#{r7d xDerבf'oqwjC${R$]ʘԃDĖ)=[` ~sVA6Ih]ǿ"UKT| n_G?j))R>}W{kz|}'6τ1`[4aO*w*GRiE#pXUC"rUc<4? hݵ1*euMsMB%R'YDFbOD,[B=HI(F^r!~@d AJfGz%ܿUl+TW;fokd0y=6&'72$@~ >U |- H \2.Ii50So~AkQRڡlԬK/ϊ <\R꼎uu.>ٿ$h,\ۍ44܌Zy%>+&]r=wBmUSP9/U`Kl>3k>v (<; 5RzlSU41cg:HkK#8|8_MZWP8Du.L l|~EQ/y.2!v֯\D"VG=¦ ɇ6gwtl&ɝ$z//NzFQ;itphs1 K~ (!<GahNkm5+7ˠ0sTTwk9idBaV6UWo>QͧyQ_D+95zUO둒gTri"xi;E0p3 EJD U\a*W#ɤZ~%ܝT^~I㱘n=1U&^,&?@H߮8e[PJDbvn=5:X&?ϰ`򽘧Gƃ@T w͈{@ PeΝq^.OO^X-/F:5Śޖ:݆=D' Lǐ~'PO^ۗ"-bO\?8,8KkT!vjE ҫ05F+CQȅ6L#Oad,I6!]YA7[}s@M Nôb8fmt&˅Km3fvu+PiYMӶL 3y%ܨ3,=[x0F#[6'T!(2v M>mO8@%O06RNjx;h60˕o1ӱ0Y&T.s\0O-o1Ht(#5Y0ϲ88[ ^>!?Z_C0q-fFkI;| piMVLCl.]%7c߬1͐c쒛)qt;o- )Z3$uQ\@[(]|floXֳgUP`H05Y2J>FF}feZޗ%I.:>}~!ľp ŧ?odLea5q2d\^6nd|"?YXx iuFARUk(*.$6iir.. .5/~N0`;>܊0e^4Uaͳ3 I.psJq`o\ H˼Nm}, q=$<1;q!t)W shT*pӗtES SMeUWa}. $Eݱ1"%g.&04EGI:'XGH|Ƚ $=U jPJ מ!)1k˿_ P{Kj7HT)P/~:RkìoUJٹ4ϛִG6)9Suhgσe**J)Jg'+;5Uf@|rtƭHhNܫ^ a1*[sٹۻ:1K c>! ~{bl.Y-, .Dt\sLu,`g76źJ\fv7 CC[:HN6p@D,2*7vdc$EEb $7V(o.)(Rb1@$t}˙-qj0I;xe]z^@ E9y lte#~( \6h/8wF"fkڊ ԊV}]pP-, w\a@+->]iG{uTkxyODI?J jrk4p"K0焸YK/͹Zdo Q>O\nBMZ& 03z+;#Z<.T9PBJ.gOC'Zy=i<4dGb)Vˣ4W`TUZ|K 0gnOZK^0 GE gZAi@ b @I KJeB|1\QvUt v%σiLvvJAm(fCt<3S^Zu LIu4ݥlg) G; &NvϼRB3J[_VYD?zHd$82ⷆԟCǿ¦M P /0n(" 6erQ1*Y6HBA RDgKSS5>S `ˌs0*wŇ^M6J^5t +E˕X.s4~@f|  P!E)(M~;Ю#J"TX Q)t6g eĤn鞔}#Et+vlI4=1'>+{ wQo܇>BД\%Vcl= _Na.YVCr.|KnmZf$aEY )ܮQ?H._~mǥppq*cx1Lp."GM h`*:ވ[Fc7ݔ@wrIgJ]b~4h?K 3D6:瓓20- K ۺw e}YU9Y}hHϘ1Re[Ձf"Y}zlj7nk/Wj=2qPjt#aP䟼%P}>6Cnr̟IPV) 8HHL?5^fO1;TvWBHE-/thZ]]-, pU1F K *[Š~zuGkTct3T~ꕙG,R*bDeggf~t4HＵULRQx7%0o/> ;~l v3)g6ߕ:C븠D:JH4GO|Lݬ;"M/%-seaD1x @f$Mw*$Di~,IYH[)E 蚍 -(LN#,L[ұpK>|G0{6@=I(aJ{C\j6(c'BX;>P[h8DZZMGqM\tB DmD.0Ψ1"p,F<ȍ/q98 -^W<=)Q81j+#ma=(@,. `4(2@):C#`00sRZ%/OТ3OqomKK .HR|=4%z3jջ eզr5aP肓T6"FWX`>^ּ>^1e 'H:=k4j:%FZ27vnTs ?h1Av]F7ISmH/@+TD"MdrIJ4ll[=9We"!f;( KK(Z tՆ:Ă^#2*@OIv>Lje.Yz_uUEbѺ.'H)3Z$m3SS=}v Z˝ S/?8̃>9ϯ^XB{z»tE[^ĉ&ĘCYH #j59e,jаW7F.@*Ynvcv_ʓk p䃁&Z(bbA.v fYgY6+Ya1 nd O/롢 1)x45ab"Z (ZEpz(0?qmm \ މ(Wn;0 ¤KtwRZi:. -㻛\)\2CUv 臚v:iJK^ٺb]^2=*߯ШR #?-LݷQ!1绷oiR>s!K*e* Ɲm[Y<{zb_ )Uاe\md]x|_gefBKpz+Zcñİnޜw` K~jgy;~Bqhp؈}Y!m`+]V>Q,&£65t%_JyGE/)%"w24:FWb DvA~g>dɨxL{7Kg5"gqM_Nj:w@4}`x9z N *L ?,`eGV{ZX:bcynXrڥWgk\[PmA !1d¯&){s(Z>t֕fE&4 +/N4t:[F@Pas@*bP8MIfY˭iK u!^Uc%DyDyWlNHuawPUwͤTnm/fҍNֆ^$¦Xt^Gܑt;x儒>ɲ(Bh47&}OewJo7B" ~.lG'{=$-`Jݎ\H-=Sm9nݏdq̬GKy,xu.Xe 燤%ޭl:$Vy,QNB8b?dsIC'`4߿b7@=[]ϟ͂h#gyg"NDzc:_drL0ol8bϿ {L*?l^«+#A}'i4uec'ӿӲ`Qr!GUe S( LЩE&XM:c}EV٦KZj7ٯqm]˦Lee493}.|΄GZQ01=T lmH0 1}Er"2ӵ22NkCaR24!oX0%ߊN( NJ6bd'] =ّPZz=GV9E q~Λnkɠ@@15= nJ2\mZl &s1no9K;/ 'tz 34 V5:N0 2fͰTF( @ 6[f㱆-RAiv<,oqΘ ]:]Q1Ru8%0oXyZ4_qSgًP9'x2ysf\3Zfk3)~xJHZ9}B`DsZ,ULJ~(YهbK) [`~40Km~X_,h֪P%DWQd GiK:l|uWeOm,xwr#sb1gW QT]qRb?1? YnŽwufZE*kUCΠyݦ\tS*nJug膜15{nj9=5_Ya:"ρWd#tJ `cǤD< + rTĎؗ|go ٕC`mm9"ãBY*y5\4A^|BȢ0n+Kq*ablޕZ~EKGO]͗ f+Olr*؅ib6n2!ꂨF) 2-bLdIE-7T¥^ϴhsΒ-T xvU N2E|ː9O5\+6Q\%FcAP ^7K 1 UhAz0[LP!U5J7\8@a8"?R!:b+X))N<<\[V^>\/>݊?rC;Mi@ ҇(D=A9A?]׹8 \871VĕYǣ8sav,IH0azPQiUZ^;pZ+|WNq0g0qSJf-v/HYW墻P(BQI5cվk80 lh*MU?63(lkHltiߨOVrG Obz25Y AL{Fh}?Vuʣ`%~Aa9`"?_ Gե]t7HC½spvfDxqsHpe)GFIP9鑫i1/۞`>>~YcP{֐YdwU9ֵ]6=6d#E[V"CezL`>S>SqTw}n >b)ē[ԛλGϱkh]M3TuUb^mj;&\Q|_,(bp3zid,=E@FߞJTYZb |1Bt=P,`2^^a#0Bz&Car"ʶCXnt%Ȓg`|"_(USlĄI?/E[Wx1!å$VK)x0j{kf`#iݍjnCtaX?JuI|8p솚񐣯5>٪[ښ+QH(kE||)~iQ}s؎TԛnNpA5F#~k3kuZ+oc"NnJ;M[֞dt%\KNӀ2٠W"ȉOwօ"gM{ZHKWPkPCbwVJ>tg2RƱoK_ՊB! xy5!$eHVBXq=C!2DP~e4= y'4:6ät8dl2-ZABpZN{$9,iRCϬ?|,ӯ_VDpRIQwDN9vHd'ɑV{lx@}XXۛw >z.~s95hu/eV~Ԝ\:0h4pILRdd)8dK=ؼۋ_%cn;Aɇ`;ޮ:JTk)5t.,YU}]k >lVsy- >JwU~)[Q_|wd{_k^늷Qvvb[&0(-,ZJ 3XZr6w\0Zaub.K^?SW_Yꕘ]!p\As Y}Xfo#ܧĤE`͎Nj/zKqw].njqQDfr4MXn [uk2E,u<-h4vbEe,(x}6%S<*.Q| FpK8A:/"ć?-tUqS2 utVc]=Y_.{{&&珟vzQ^;6KX|'hIr|[[6Cb&>.Mduu^%/v*;%zaz\yT֡9nӁ^j-|Z@Dw7=@VWꮱU aFxAvw4guGI稴ƇWn. )Sa+, œ-<4_R.tz֕#B~;ـ5 '[lkACTZXHj5-1UGSȪ, DfOqrML.>_1 ec7L[v\R< C{<ӫ$̝8@]2/\n˂nEJ;Z.o=PxA3zZӝ\<<܋Qnw>kE p.xUP,>Z|:93Uv<'b8/*k9_ *F ֐W(jm0nzqe@4Qx3 g̺4|;p5S1Q $[ łTGQ39g^aRQ6*&XYfrtJt֗A"%FQO`x{7Iq4u8@̀EI'5lY/ZrwvU%Y!Gf%mH?:$Fn:I:hf㈆{]L'x+!~ }WdCv4ƚ?j蟕)"qfP⯖}X/BK|\"]'lSћҫ݁V]͛ X}\@;?e=(l} . scIK^KKxz7زBu.K2me«r!c}fll572-ǕEat+hJ> uʜ"1KȬ˫1(K'ߤ7}6:N` @p%~9dY**T_ilMU1\\ = j.OA^#H"?k>@nu\O'jE0()a̧IM$pto|4-"rx+ٷ˃m: Z7=;2qxԢ J#zn0-nڶP:gmyz`Ϩn 0"XЇb?>6>[vF6fPP󾅈%& ?e1Jc>s?6܂ԏ &ʗ4+5.rcZd`e =k2R1ҔNә5rtݿs%fu G< Ͷ?;QN:fÙd =db5<{D133*1Hb$ pBCCpK0;t{:Ɉܵ?$֯pO<;f$L;!5$}89BVH<'\8b.( ;LoMi `GDcy,`#,DQy  UI&Bܘ[ٿTΖb{}'ND-hFXz | ׶g?v1V<*1*-0ڐ:ڂ² f-kηe逜3iiMP (Vv" U5 |^q_=OIᙝU}gxriTLfX YK)7(F= z8L6, W&F!C؅,CJyx>Xb*_3"]v恰单&n,bgg֮.afA["㬜o B B SЄ/Q7YkdL:MW 49+DpT5jry)]-w½ay(F[&9pj{q󊪱)#7w4pw̴D9>A ѻh#,*&?<}`׷Vo{A` <JX٪L'IX'o4c+!<5BGgK=ܧ9 ͵_\Sp?LJ5H4`LFW-QlEw9f;KV<;P8Sm#fSn ML7aQil;Nhd8ocmw ,7)cՋCd 慗0+ GAؐ2rM#N~&6̆qQiyʲzhˤ$ώì0Y{PAiקTt j=;˯F ݋2dR>˛+]`uŬ%!oC >I@9@ „U1bDC@x_ `xā'n#yk߀f..$fqm{ߥΥdq ncb! ֯Y _7 Ω0$tpwJdR5oϝC2ujBbBҔ'C,zڏon>=R?o$.^PAN.%̞텶BrBQmN:wI;ɤsi|Jrok"zik+Y78 "$6+kե|#-$Iq8k7Sf"8d|ߛ]2cҢ#2"B[W4l1(T&~2FYg%YRυό*ZƦ@^BPegiIl& K,a70A̴ӗ{F( ,x ?+Y ٺgN)B`#Y:,r"˗n= Н^.6 n s-EOLceUBG]>fYt2h$,kuv"di㲨Tq3Gt_#z'U!H3V:5!v~vF;OGC4'|{kifCk#M+wii rgmn$ ƙ]{XTו6Kt`.RCeՊm)H%6 z(0Q21-J?)׋dsY(  '6N. RB +CN,s'd+AbSIoq0Y0ww38:Ðt' ^)/ހ7EH_m"r- Jn Ė TBc6C`@:qK@,DsctNڈ^vXf*@sN>fao2mp03486~W dJg@X-6ڨctnt/|l"za V+U<%u'bwԵ Ax+&K "WF~E#&f w2GDB 0/v^OmH.'>Ic*¨ 6$iW#try3_4 kH3-/qپcY~q( (&T |2ߙM#>ڪIXEMx] .[$СL-ox{ $3q=ujzz4[F~ RT飢W=*k*Í0Aj8kq׉R@4k]!ZvL^R+Ys;*$. 1,XXsckE^X;S4>P>siZh*wI/07X tv?ۯLn=yQ9ɪ]S;F].=gdAŅjw&[?Z_-i6~R@Ye4WDPZ@ KM9rGWtDxba?) }z 20[(8-1i#sOx〰QW$'B\QZ3(@AwOmj@lg)jn~x9Rx^j+ ()1Q>kQ4NYtd _ЍHx6!,|bj|Y-^p7yג(F>V˹-PyF5MV :=% /pS*h1" }B1]_y6Dg#0׶Zv@Ufꬃ4בP٫~!@$H`"%i۠ҼC4{B4hi&ex5y>Ѝ"UY}b8=8oF}&.yjHͳ]Nl!=cU;=x2HT)y0D}b 7jrMKt8H&p-nn Hn#JLC{#YX9V;>sz9Ssz2DDG[+3:Q)nyX4@ Ǎ߇ͮ}xquk ڮZT|sG +yIw`nF )PB03o֚snn zjHtkd[]a d1&cg,gg{Pޖ47ӥ.V XT#Csgip_RK>b)({/N1@0݇gJv\1dyݺ\!ڣfX1hiX;-$ 2Wt>jFЅE-.;ECӵ7́V͋L/J3msd>@haG:^bi{ѣ7[kތ1hV32M5ל!%Eb zN\cyN[x Hro73?ϏV >FтDVo]nWKȉ9Y&S`ӂ-J3[N; <=RlZ&29m~%WNȱmZ~vl b2`b=IUӹZԙo5_/Izu2/ i-4\K\A6x"l1шFVr8G<1XP@ KR7l䝔 W~9W54&=bJR#,)usW(kK9w}e P=8XE{^|\ie&QopmR}h/Wu1/r=%qxGޒ4.`v0*uc#DF{d1unp1X1 uL|! ˽fʹ.6 M u&n." KÁa[{0EcVTtc_$3uCaK]U[t7Az'N(OZSR5ˤU-d\ppBr xg0`j{fKzG *HvX9b?M> Ǧ|RTwWIcT7ExJ՟R衞8~)͘[J5Zɢf^Q B2ЧbosO(U\!A 2 OW&W5 -ޘCEUڽM *mIs/6!:t@[OA=ݚ4R yQX Mu:m_C\bل 8:e}IÀ*G:X?O>u #8QB&rxmߖ!Jh^ߞʣ2B {Rn4Ĩ# aҚEp867Yo_z h?qd& fDA+5Ƃd3va<+$9Yq1ߍW\)* W{10Qq,Yt+f‡ C h[ۈeVKh5 h_qCx5E D6eA7 xI(6SJn!kN*MN>otG25w]>]|`ui6$-gŜ).i1}vKC3(\O>WpNs e@SƎs^CEI-D @3W\p›4o<$\S1'MZZbAwElM7U@߈7;o};E<1b_of(ȼM tBDbVKx"( Ywϲp S:dfu.&] eg V)^wFdc>MugU3_eo̍XXN?TZ[z||hUhZ/;@^mxܕKJ!_2H m%SH'dz2۵Ǝ1r:袭1":?K5AЀ,3=(I6CK<}~a0! 'źˡG#}"y&q6f"f394Zc ˑ(~EҶWV "0PUPd\~)pWCLIXwó.xYK6@FW{Rp,oXl0]UŎ]ٮܝAоT8Wqv}L"eLn>t{@ nwc܋xs<>۸U#Kg& #10,M<4]Cf0SR3f/nNnEB륽.η U`JԖ92@(fϙhwD(%r ~#:@#xՀJ+4w(>Y#BhՔtgC泐)D͖:>?EjߊeҢO/se=mXNy L$MzPΓ-/>zjURʹ-% td_2/'eps.( (# BGSy|`GU;Ră&O+ܳo4@HrR,qu(Ŭ}&̿  F8a%XwYtϖu.v߆eOͻlKOtu5p Pgv L,Pt)Vn/iyb}~ ¯n9~xw⩚ʮ;+)1v'MN .: -/\7Eu!?ކӬ}3|p;> ?EyHYNՔGAqgC3/q: ҺkGg&ߓvG8NTD8JD_LeWDI5Q]zB Xjݾ TfՈ||}IP4H, M4*P{M偣_rG` ,l) ١95+gKNG˼Jl}i+%,ojW)3# bZ3w'EtzH!Dsʢ- A B)֊j[?Upb[|'hb;ދi#_ψ%G git1YQAwk1ҕ}͊tlO1M aRƢOָ [ ԍW;`_rQnl]j<&-+{p#eD8"2e~Lvz?idw/ŻT[7F ti#ROGGp -m%3Ԕ0+:頜i k%5SDZ\MTs \{Y⴦ɼ1ϥ6DgT6_hաcqw:o=+mtUWpm΋iMP<8gġSCWJ^ nUJzڒAUm,h#61Co tvOS$H MMH;U;/2כtC4b]E[v"79r!#ց1%ZdI&$,/> R zw[O}{5mKYyN>pd&vjHτ<}0L@<צFqhjwsʪ }:8SL.4 {O6-0G,Io/['2_$1ikl-)fC A_ 9e4™G2(1B+qy& \-m@ӞJ Ӡq[EK=ލl/9y9jN}}i8[{@Xz@@-_o!-[y{ZY&Kw*eU7]]$T#H(89k0_I<a}JWӷZꋻ?SÌe%3f٤0Ԋ3F>b4gqU [g0O][Hzi~} m|k:G,%pkq`mJO {@-qJJs*S, Me~LN1腶ynĠs 420;fzJmUzEIX)SPj$$ fo^ۡ6Ev"@})ϖ}/=py0>Ax}6mv|`$7 b*68- Nj;mxJ%܈_RMnXBOR\繻cQ~䞺.x®oj(6I ĉݦ@m먘oYzpܺDAh"w+KvV!rOŎ[UYfUU򚶣D^ y(k1| sR4C`>{$bCX{b_0"p4?т<͕/ z_U&K;w$X,M:l◮ӊq9Lٶu{N&Z;X--*P-P/3k\l_{TR$)cWf>n~J-TqS;}cH]>#`.e-d|E4ĸCJGtǓxu+$ol^= ޫ{+t@t#i2T؈M ?ZT\N 6^¡9str|޺Vm,φ^ZdcqC -eIcxtZofb% 'ľh% oc^0t=!M4뷩 h/Y|Ǡ9ǥO0D$0zc'jӛ$wTաhTMzGi ?E3 3}:EY9Yph"{e1EetipJc?rxX`SKC YZ&AaG?K\^zU8oh:0JBs^<{4 9{KVQvFCx:lG遶[&N2CҧgĘDI¥M_IBK5.B,ٴ htHa9R}ܽeKtCY!=.у/U_[1/< s~Ms,^S!ġu"հi)soh3Zgp@׎Cb! \p~N@0 BzN(Z2Sx <- HyP]wnO 9"AXTrkyo%&+Bx#}쁊{jt-# `*R&286Jl1a_|E;$YցTgyPj 8gK9M!Ta>-R]Dz ЛiʷJ3[0a|$W-SJƯ`͕+=4/8tn2 ~jP2gAP:(a~4mZkm TwxRd΁x܂nqR- MȄ8T QSzzBC{sNl$6j r*=QFVv6 iitߩ:m ְU>Auh*pH-j(k+݋cR:DU&)D26yU"+@N=n1$fnkƪ&9͎G/Bo@:m{ˋxV]z%@#ĊK/ưZht!RN(1H$ !+nӲ:%PT1Cߓ1Ǔ[ J#j@oJ 3SmA 5kCX"8 㽪_I;hbmHI)fN˦|qs/* hgG:ySxg(^ffx1}kHCx.ʸH(₀.z`Ϊj!NSV;-Ν_\Ͱ`vK6[p3dT7 .5)pNWoy$;nET̬b3G4mFgUKK M_ʵ[41(u,fB\t~-T`vq8cMKw  ۖHfb R2(v]W |)?I@V/#XhfJ݌IGri3ɅyH?eRW)Y(fnmo]xŠcCc6#BiY 7f@j,TXNHm1!U2lAyY} AQ 0 TegTJ;{%u*H_Y&U-bq[H5\'O?,zfTqs1EzH0aYڧZߍ$:6E<;4;ž|^xK58ɲC 6]^7x6t3sTz81^==S-,m5~>I2C@TaGjo8+ۣ# dH )US(X ݤ8nY5-SG,Xn@[m>?W+ ?ku?Qվ~wϹ6P94SAuXxGK@J_ieEލD}R,Em># '$3j"J]}CKmc\)qdk4Li ]ggVÕN8gؒ$o5v UdqTqO`[ z@Ddq|B/@zbѢ&k@STqxF! _DKb=\56L4{ݥ mM {)?*lḋ`Rc+K6oE;TI> Ca2 RLhvG$T1{ό//HBп7 E%Mᔏ"cb#+'hHz!Z&ǒttjAh"  Ah|neM%)gF=6)ctۧ!>Brm'7kk6MOvWJ=[@A#]wFPٮ8̺T;Dދ3>)B)}!0v8u+f'|RTR< .UTBGLIF~ҫIH7+qʢ(Kkk݆KD%L ="=l|庠MpPIK$3 ٿob㑿8M? ;f2fV2S.]b]}\F1P$m}xfEHA<ǔ%ԬdyWb-Ẳ.Ob2/PµtdK!K"Ԝ]^PYP*ɁYI%NK=#Lgm+U&dy`(}/X•mo΅0řǚ͊vzwM(i׹PzX9МT9yfBf[ZϟZ>8Nf7 3XjdYY kh%NdF};qf X ﲃ(ȿmS ", A4ހmMBC[~wݷW-hsT܃EJ,۪vm$ 2!>qPq9_YRiAȗtX8#D"3L!UExL?/0oU׵o}0Y<,%!JY8[2[.2WTA=n+FPJ ݿ2ۘy?1ZD)!j줊o!_u#jf']JG  A)cqs,J|Qb$!Ε|< ivBt%!T59y#׷e}*V?@H>(t/pf A4MFԯςCjWp 6.cqCH\"iub,Z2qkxp.s.Lw2xp|:q,Fx/}?uLhǓx*+g{9j'knFʽ|g䎄nNz6oH1\46EjW6_J4Gw?6>eK^`7؋]"{T~ZK%wkUs|GQXjJv0cϼnKiK %K(eD&ޣ7'"tr a,>ڝXS2ai5ej߫\@MU&7( nljt;X?L{8(N~F}(M-3˴OkLېg{(Yf,ӕFnnk\ 7Թf,ۗV?]uFPso&{ :b?/θ={@"頑+AM4pLZ^bx]i˄7 @a/˭"q#x&̉Fx3)-QADʭU!:0sV2*x#w"NVA /+zkh˖rk{+׏@ &aKED;yYoGHVg}#:\zw~ VlAcWǫ〦鑷ϼnIf#"//qLN'}I:A:lZOUvXjǐDժ(|"A1[*w@.(o\ëxe:&jR05BS˟bIeZ0acqѼaqM}0ݳsOL'ZpXfA.-!3e| Ȳ9uN55:hL}/OԴhy"0yXpΧ+O wquǿ<5QH@*OIYru'sg8P"<eVBwgݭ= >f*Jmac26|4su.d P|+)lqs0_-Wk>y$=P95Soާi΀W_n?Tm76əbRO8iD 䏀ړ5sC1"., 6>;Q6zQ$ VƶGnhN[gǬm[Y㻍(8AB{RoxA"62d8f/Xr-*,&Z)TAAJ{}-a8c"ho-_Q.eA.dmT#w#TC U?$0գW:6QYd|zg?\E>k#j{nB$OVCoJݦIb]Efbc.3Sm%g37}X fo:W t,ޜC?RF%+SE.,:Ϊ6H^OZ~08hqb$tYpl * ,g4l8m*BgJ۞}mkEl*8iѷ3PiOxou9_nQSޝq9v*O'ϐoICdv|J[/^αW[ RgRVa!XsS ATCKwUp-\g ˲|l{8b o0-(5Vޫz7Χ{j#c^c&fm 4ӍJ=:7n#e% UA(h;*'; u!q?Ωh%1#ʴppLl^OluD.deխ#>v*Yɮ" sSgʘtbRVjgwMOG^X !h؎Ρ82DX{ayލɸwPw{,P7Bzp/]yn̢|DD~%Я:۳gW 0;r\8p]@=&bUE~!g](',D-:񁔉Wv:-[`HuCbCl$P@z\> }Uwl*X/g:HVV35yAkCJa@uؒQuQK ̥KMַKfGɔM{ޜ͹DB,;}*p/c^qXj)%7FPumѩ5 "8zOvB4>HS)I,3?ֶڲw;J&e€;y 8 }N6eQrec#\NX t|ZS3"WrDTЀ0+PFfw0B{⛮P:PAg1݀A˺'@= qI@'&;D8esYx+ {떉.k_*ƃB35=k#Tp??Ո Wy_;p6*TJtzU#EʤT($9rJOU}&MjrAmCyap7a4dR0DҰ_ki2P5X p1&߽w1zs5g5k~B{uQZ2.-Mm7{."3wf $KgqoqW⼙LZl1VZ=T@z?Z ,c5,4#᭣y_*6l|籼!٩j(CW˝;v6/YEHNHd׆zg3(ߟ_F kψIyyKhQ<kISn3vB!Eq;*s/wt)]IJ&}k hgO41t*:Ɂ*M-D@c!F ¦B0Ehj78~PМK,Itm錥T8jϞ[&)/cS+lgbcKa5+ rˊ%PCLPS 3KA I?hnU^B#o7 4ƫ;eF9sN.(XPmð#W^+e| /'v1_;[xkjNGw7BoR-?|L<{P+!3~7y޳3s.~rWgV!?7ޓFY<\h1У,]gǎ]ym-S2ŗuI&r9~#W[ 1Cag\kطeD{_lQ˓Q##Ϸ4Զ 8Is8 `k1‚Z!| ދU]6~;1Duc*GIIo١l&-ȏ+.oJMyh]_uAwu'PMURKX|YOaA]T5bjF0ZDخRYO=v= !i+ڧ~`Io/&-]6&c@te>)0}2E,)ՇvEך|,ZGH%k#B8"gZش*.^G!a;s%dʵ Y`l5 ;VtWN7I1Tuj^w6} fyv=`ğ1u{1ebv1[E?xUQqI K̥`Ntߕ/~=HեY5n}irbK}+ޝ+;5z(Yk9"ȾªdALTg 4' r'd ^C4ztq,@ vD3hxE ~^pUh,tqA -򑳂"`͞D)7ˁLRX> d;Ͷ|oYcÈPcWbbnR3-=?>3*qO[ y8|e,?{.6)[5pܓީZzڂ&Sأ<Ub,T+<BHaJ>^fYqBƲS2tFB Mm+;]XMpsH-'/Kos),)O7~{ )$D7ަGzPq>i% w:zԍ6٘EWfSbu}#a)ʈ]q29 /qk$Ul-}G|q ѮΫGC.Qcؒ'ehڈ,u;~o#kKBY|<\{6pXu 44*G,TNQƿg,%NW i:wVgibT#rԞ#9Rqk;4eS]D#ϊ) PX/2A0a<+ljt^_.X#ב]00k.6F+IAP*MTc"s1ϓ\}iGndeI (DΓ17rQj:^G?WzՅXvY&7 !O~Yk;AwZhZD).LnpŰ,ߺ*N []8YVJA0@ݹEAA@ȫ9?=Gx+]9=ڏWτf\vmIB&”LKx*vh/&r r~HN:W rqYM$(xV^-I kiIbZ-Y]S@8\,DjG' N *6ouj'Z#0J:5,?zd#%7z}ĶvQ8ε+sRzAel> p==da OX`?xܘ?uב+Daoqa[FuZOm.+O( En1Zf3~`=%|D8sӦJޮ/Ljm, Pb!7w Y'WPo!ddmf]YTQ'\ғ|8-ۙzosun/_x䫸&8[T$"%&*n]j\$ @xܷ|3'1XX^  D-ŗ +YԳAݐRWOhCT#[%W7Kh:C93'ӳTG"=&q^<|spBI: .:xtϒGm131}Wv1XXC&0ػGZk} {Q,Oh/oY_κ..g,I͌R*gGM>vWz[\j H/K2m2%.Limֽ6bP0)!*.80m*٫- xxY"L%??B:!~>|P+Ql%Ɋ>"GVY\:$_Q=c>_݀kO;ʅ$Cf5BLXКk9]9d|ء+e106s$?Ag Eܞ(eՉSaZE(DJ\#o>|MEl@Uǻ i,3Ú)yhp:i/,]q$wؕY4}͂T3#>Q˰;x"o"E8@:]<fez5Mg~kOB9 :\_R悽*`WD L1 I&]KrLLNwǩYp9Q,l"~sBꝿ& ;yTj% U7Vⶁjfż12,"s] RU݁(=W53-loL1CY}y$ Eb$=icn:s<>K t#QwEj$;LoPM/1z˻_EE$ظG}o&GJ?/WΤ'%:m"UkuڌDD؀@Ng7إm)͍F,1z|4Uh*ؼT m}B8E߾)@e(Xk&O:Z.51RfA r_)K02]cyҜ)ͱʙ$<o2j6/~%K>N!^%_;{;3k=ea}Q)ȕ/(߽DE¼ %*8PN=Jz" -&y? }Ѱ-|5e{4Y)7uakסlmɘzYqgE' 6.˜xavM_CJmGjc!_j?6!U4:hUt/cqqնz/+ɼ%(-2 Fmt T3L6L__KQ8 drG"0ƿ޽ AFvk=I=KBk3-Y]L!jGѨwpCi7 ~8q }F]ڻ)4ʉeoYl69cb>i?N#hO8v~t6m ȗ8ĶiDcv; l WRmЍ{>GnT- BMgHɁ3SIti I:;WB xt Ш̾4~mnCfn Q=.FyIlhFp2rCzcN@x.W.,![x u@MJx1|[Uɒ HkN)iS LݚɕL;`,ąQ/luYkK4ݩUx&81eWӵG4場 /sҍ7\QbݲRՖMLe:p3y!}{O/PvR觞u;8V59uZp縜nn+Jk)оB:^ԓxrZ6#^1mX;9mٝڙ3"tMVo̒d-≒w4GϨ2]Q $/E`VbIqektҞPG*]DآAtϚy둜+\m4ojȑriYWi+*> is<#dk,c}M :~_fD=.7\5"eXyFCzlv EB3$9Tb@l.ab%6~6ļYa@£tKZnb'ɠ9l' G0nm>u;qFvoRfF}ȗ.xi0;)ˬHao^ j'7yMHJ^;_,TO "ŬV5^|_zT~{\ec>~C{$EI!!h 8+ ɂf'edp\Te/.ڜM@1'6fB˄-5Cէ`&~ 9Tvr6uHB|w7EǫFց„ϒoǢsK3&+an;~\BR0;>2ЏE\+8CE(1lB=W|s,Ps;ǻ_?`+f#'cD'̗_/ys8uDlIi`D\Bg gͩ[ br&0-ܺ ΧysHjCNw@(;l)o/&ާ/+P[A뛫K)vehlշ`D³#-Ɠ 1'LR"Z P_4!/gPwv+%:>YxV~7Ǯ wxwrxN*TQn:g:(X &8OGZ~y m#ʁ}0}S =md8-a5f=oܦo:AϢ*m*DcǦXf lkgVa8(20ylsu_j+{Q;e7 ]Vs WuiiُB:!݋alK-ϚF+O9+$|Kn{V%&8J_E#Z0*J: K' G%|KڣUު0=t ~OwUu,E_|RC  $ 3Imc+v{lg c 5 k!0hy|О:XƤtC&Yޯ^PΔBM֣:3n*qg8E0A;݌;%el;̔bB[8ɦN:$B;lj4㱇G\:khKthhT޼S-b`gE+~CH˪Rg+I"A"Dž뾁d:=wQV؆p֮fɯPfNk]' !+#VפʵbtO=l4f7gA~[\ Ba6K_џ()VHP.MEGfBI9XjHRqqU9 eN%|D"ޘP՗^R4"v !& \a6AHn7HG52uqZޤؗMșax h|Y @ bv 5[P,\&|YhMj!8kKc9݇T*PD(fЃ ̴rh-&®/hȑxbdXvZI\u[3~NiQwҙ y< ? PMod~r x.7 3YBk -Hўut6ܿi4j |Og{GB|q~UMLw}Z2hx9C#4{zy~;[}`h͑q=(6xШBb}$]8I xj,AIYf7S4OZu;FTlb {/UhA?aմBkT<ㅊ;E@ᡝQDě|C0T2LoJFGZgznDW>N"΍Bk2xR Ťp/i'<>!xJm;"g6R#ЛiЖڮ RNrSLwP{z\sB .gBv n" Egfz;Ǿt}Ja3TF,+OFcd[8&mpک &N l7[kGV9 y`qx} qDu>ЮՇ$V =_ҩ&$E/UĻAӭx 12=!trCCsaBԝ1ϊL+&I~zZ"8.ǔPyr8%RD@IYO {_A[8pq*lnOFEϔs!y4١IjEva\. %=~nz$֊(&4·]o|ʥ#Db~;b`erd:NDtDnXgU+8VWtsIb“@&#KA!`;*Nx?@6REkZ&EfnrIspf`FƼx/T#O{5˭\N>c?ĥ_BEYN$ԛdLʛfRߌbNwzjW0i gWex)HߔU 4s%*YS-JZ' Q3ti3oڿ]ӎu)8^ .Yю-w&jua^ YƂbg~szRSw$),I,H$wZHڵ z7]R"[߀k9ߡLP}}߲߰|gD]_5: ¹/hs v!= nMH"V⺙NS=M@5$rTMiSq 4 2BZ5ᧆm8g)g8 WϷsQ!{xPM-cx2їLtM$t[Ue}~&TKƔ+Q`'UH$hSh"|F!e—ѡP_r/ᵭv1OC|yݺ`-'KC5h40lgC|d`W(.N94ut%E\<.nN{w ]dدG:0RCw7WMTWL2&*ξmGAnjiH2!!Q0c?ęy]PG+(iyǬ3Tx}hP@df!V¾&uŌ#TfitW jwBWy\&̫*rKR7ʊ.>a g[Ǚۺ ]ӣcepއc@WVVy,.Moz•M NeM`gJQzM'RSsa+.alnW3yFەbhtptL*|Fw,O W5w@dD]VY y~D2vЋk~cܵS?+"-_Gw9To(1n5`vJq)@}g1$hxNc64Mf F )܉tb$=ŴF%K)9l\aB('0L a("f̒d$r 0~mGN5J-QV`|Ƅ=1][RaK;R\( {ԉ/2L+U2A.*UvDWB<}9yRMܮ١\!-c n>"h"50vOm47y8~ff `ek؊7,Sv'߲\@Rdb 4/f+jJZi/33XKﺟޝjG2JվMS484TS!P1mmq5P|ҷ*\Ҩsy.ܤդLR]V-ʅDp|P #N%7' m 0K pAW.S q譽{?uА?* 4~SԆ ąV8yH][>|L[A{oڒلTb} _}/aYSƕ;{]h.g!}S^ I[RAf)z)%?#VՕ&"c$_oܬԌJˆ ҕ_vK-Pjj-&S$]isŀ-PrjaeHgM!u;bpTXpf@%ljkKr JFs-k8߶X݊Kѧ![CaB*-rq!Y>DKɻmkC\-gx q[6-j+gەG29ϿWA5)Pp&Fm)']ʱc͏;MavhPB];{>i섪G|:to~w.&&vҵs[GN*5pQڨRIboh*GVA{TƸKR'*2W,j/kh&[;4h}oj_*. V"_yyh6|~.( fZG1GveW<{V)$5;UcNwL_lhܞ2kR=.+yn^5cRËlDJ APm N*W6MuQHR߷a+%H\'/ۆPN@A"_ޘ3D,[ ->K`}3Ï"3T3{Ìī'+>&iʞm@NK?Դl .)ź/9Tb399u@C }, 5$ O]*˿mg|~ʣ-?qJ~9Wf74),h\d^Bй쾒{c2ARڟd<<`軵 T`{;.1@c'[V=a8Fl嫢 3R4>1к_7ݍD:B=)i1i{Fyn`%jxY@ 0w;@B6q4={]|x>:t\}ʊHӷF E-A[yKIA ]o< xVwD12-p>+ju. 'Mt!T BݞbC@T Sb2g*+Fzm :V> |ҥ ;1.eFL`YmFKhQy%9 ;M0NwySһcZdU}@hb#"rDn_ځ kIfb!Pܬ@jI-fw?uAME,{sounvbbmϣo8֔&Ua r^I2{tGK79J,ܼE{+_0sio7W2nNk o'ѽ}(씝ko绬=,*%ʏH-xv QN9j@|t'3 KZČ`7 ŽS)K5 ~=;TW3{yg HL ܝc_nq+e#'U?J+TZœ/Y7K{ L_tYTEΈϻa $ِa=9Y(JQ](Vq(:=pVN6[HZP<ԶɵXl@?e{*b܇`"(j 쀗P4iJaպS,ew/sCBCU\ЯW K%jTSj@· %%Ɣ<hRǮNx!jF3q~PNnj"USW)tK!'?XRfBmWaaeX2溙nYg:Ю$鲾ʥj`fguǼ_irFWՋ .*!el}=qFv14l%w\/M7̭f)d:lYY&MaO/&{6k L9Qz7S_xSW1Z)'H,(K 0eF43C,>4V<(eZߓ" b~{>j`PkS)ڪ8&8!-QW3$CW-4!v^X$ H^h`H؅=3jM"Bԅp)jLglWL2) T Bʞ®.1uK?}FKUSDiUW꩓ȷ̎$*\㮣u0w~-6( ]yZ9}-#C,AmPݻw76Ju('?3hNAk2ԲryJhlH8w5d0 Q=ɘ%:UJ0]vvE )XI5՗*ASD!$KѰր2ő ]mz8ngN m.2 8IyQб eUNOKOOV; ,1mxcHuF 78nc(vn!XיrBn@gZdw>s-k`Pl:;41uyMTe-n{?i]|FMbh C,OorZR+IK,gǏcHPP1G1O{҅85ba\vLt*'eBK^'ql7^~Xc1hnNQYZ| ac󬄇{P6vc Ãb5Rm̑y!di”dx\}fmy)8g ;R*ay Y0-{r Y7ܓW),I+R؅S}x*v0Sp3CynL] -qNr,c,pX.#+HF㆐eGȮkD~`(j~ily.q>Z~f #LP H7zU ;$8Y֭i{)?RpDi ^ŀ>@PkѤ7CLjw81u< 5Q} HODuuqN$ :28KB0RPM94<!owZj|(tE҄eulQ/U:I)/'a!| 3DCrJhW>".}4Z~*­)ȿ3p H˿[H X0oe*^.Z.Td!w 4Bد9!~=A5C+ 4gZaW qݲgbK3^  /l<TmlЄcLŠDya%Eۻ8jgFgĩi9ͦ(>5)t^PIht 5anr>Q7,oVD$7'\?Ngkl|,0Dæ&;^@Q^tm`󾽩C?'ɨ'qQ@9 NrJSVcQcE;Yc~_mr`.#$*M̑HFtiR?6&'tuѰUqUwT\YO&IQ]Ӆ4/PĆ&Nz!3 B<%g$&A,̢$S΄yeA]pfvBrYHȮ ENm'D(_ Ycz{> o%PJѵ0`3W,̧9s҈xI%ƁTևh.dn&x*w v*WU7> Gl%17MqPfP kj d^eV 4,Dfo QՏ]WUW4;ZYVC;~R)ǣ+)W5{-^nځȚŜb\n\ߚo+D]Fiڛ!đ4МHo{GEuΪrGDC7CAHu VnӉLYLh7u;͋yIHjcnχ1 j*s0b$,J,~Myvx&^ޱЄ?8+=R| p\;[=Hۛ؞!l-Pbo g2;s;΄1Vή8BC/Ju! 5-npi!W(0s";nCZs"eH ߓ`}p;0cxL&4"ʆ4?riTi!{va),;k? qw2QzjhXY{?V0xŽc)r~I0ȹ?CE8'X!1}xUv`SV t[ Fx9}'_h{_߅i.6Fȡ̪K>4!o_<,e^xDNOJyDydmcX&*ө#@06 1nf ,,!2.*em0fa07Vc_B']yk]y]x[X~uwWy(1PibưEXB!F+EikY:/#-\Xž;.1X *3LdÊ^XjuPrM(!J@ 3x! P* 1-n^*Bxz!";J$R8*X-# 6)]W/ zÕ k˼P)>Bζ 7a;bR1TCsl4Yxj^h%Ίd‚6qW`#@S#T}GqU(4͞ v(|ۂYHHMDd \Q҈d{RX\yG!6aHi[;K߆v nS€<3MES(`,KUM$%rWʼDK(1udnDPJ˰8r;Ymv 0 [1|<Ꞛ h*e~B]-C!^/,WRk _Y>کmm *`#"H*T\mM\Τz q^NLM'ZOzx|PVM"=)'AXEn=uHB R oQٝ^6Lז^Id۫oEP80J$bvvvu B6d=7w t/V\XdDu@8č*yl9 h&ua4>ue[E-g!~[֐ӜxQֳMH: CͲ{!<`M ,ʈEm[˧R PCp9"{ I|G0O΋ciM00/'p{`eDUd)BPUUс Ww{MkraÄ Xب7++mg 򋮁"h 9cC`XLa< ˠ*-Rq)Il=(ȃ$xdH$bǭs`uXƒ<&I^$WQq^NA#JWL*^}҈"U7N疫Tfݕ0p 58-b5cMovٳZ3vVmLۃdZPѭ̑=c+nrp&nCSNDNٮ/.rOwz,nAj[UůCZ} )c/9mK 9 ޅzKrñ ["Cȝ4:=m=œKͺ(_W;G;ŖBN% 4^v$s+>I{˩nƊB}qsp o'p95wOt>54vz/ L٢-wÐ=!D-pNts\k.LMP]/0zuJYLUKE/ L$N0Jmʮ⾍ɘMzFVA6 !$.XK3W | =d٩/.tZwކ1P;5΍ᾎFd <[)iU#HS!M66C;sv#e i;qe̿6͝y4XDM ;V!0ޔY[sБDY}'& :Ԏht@:'+W7FeR.ssG_: &99.snfBLNPᇗ 8X$mNX}I|VSg_E{)Ռ\?_ىlfGOc5ԲZ< 'o.Y.S V6\>V'Fwʾ[aڪ7i OA_vp1PH#"eqr\#BViǀ tY"~a s[ViDtӻUﴑ_C4Z,uI6Hr^pn3hչZw-kDYWY{Q&ދxt'ɊU32 Rbݍ򅻁A{|yxu^#wjءjgŰ2f܍GMi1 9n([p~5ŒuXF-=]G5X]<C˒%ےj nd^S/mY,K<빨eyzT$&^w~P`4pz?F*̸•I7GXROo̬(օyN#"RpaaeZQX)&f-Px< -4Tf6v|$'O!ctIvKP>{PX}{2ʊ08Zm4#+(o YZ